SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g36860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g36860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g36860

Feature Type:gene_model
Chromosome:Gm06
Start:39235800
stop:39237101
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G03050AT Annotation by Michelle Graham. TAIR10: cellulose synthase-like D3 | chr3:687873-691629 FORWARD LENGTH=1145 SoyBaseE_val: 2.00E-123ISS
GO:0000271GO-bp Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:0016759GO-mf Annotation by Michelle Graham. GO Molecular Function: cellulose synthase activity SoyBaseN/AISS
GO:0051753GO-mf Annotation by Michelle Graham. GO Molecular Function: mannan synthase activity SoyBaseN/AISS
PTHR10587Panther N-ACETYLGLUCOSAMINYLTRANSFERASE-RELATED JGI ISS
PTHR10587:SF9Panther gb def: putative cellulose synthase catalytic subunit protein [sinorhizobium meliloti] JGI ISS
UniRef100_B9IPJ4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cellulose synthase-like protein n=2 Tax=Populus RepID=B9IPJ4_POPTR SoyBaseE_val: 2.00E-133ISS
UniRef100_I1JAM1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JAM1_SOYBN SoyBaseE_val: 3.00E-162ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g36860 not represented in the dataset

Glyma06g36860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g36860.1   sequence type=CDS   gene model=Glyma06g36860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACGATTCATCCACATATGGCTGGTGCAAAAGGATCTTCATGTGCAATTCCTGGTTGTGATTCTAAGGTGATGAGAGATGAACGTGGTGCTGATATTCTTCCATGTGAGTGTCATTTTAAGATATGCAAAGATTGTTATATAGATGCAGTAAAAACAGGAGGTGGGATATGCCCAGGATGCAAGGAGCCATATAAGAACACAGAACTAGATGAAGTGGCTGTAGATAATGGGCGTCCCCTTCCACTTCCTCCACCAAGTGGAATGTCTAAAATGGAGAGGAGATTGTCCATGATGAAGTCAACAAAGTCAGCACTGGTGAGGAGCCAAACTGGAGATTTTGATCATAATAGGTGGCTCTTTGAAACAAAGGGAACCTATGGCTATGGCAATGCTATATGGCCAAAGGAAGATGGTTTTGGAAATGAAAAAGAGGATGATTTTGTTCAGCCAACTGAATTGATGAACAGACCTTGGAGACCACTTACTCGGAAACTGAAGATACTTGCTGCCGTTTTGAGCCCATATCGTCTTATCATTTTTATTCGTTTGGTTGTCTTGGCACTGTTCTTGGCGTGGAGGATCAAACACCAAAATACTGATGCAGTCTGGCTATGGGGCATGTCTGTTGTTTGTGAGATATGGTTTGCCTTTTCCTGGCTGCTGGATCAACTGCCCAAACTATGCCCAGTGAATCGTTCCACTGATCTTAATGTCCTTGGGGATTTCAATAGCATTAGAAGCCAGGATGAAAGAACAGGCTCATCT

>Glyma06g36860.1   sequence type=predicted peptide   gene model=Glyma06g36860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TIHPHMAGAKGSSCAIPGCDSKVMRDERGADILPCECHFKICKDCYIDAVKTGGGICPGCKEPYKNTELDEVAVDNGRPLPLPPPSGMSKMERRLSMMKSTKSALVRSQTGDFDHNRWLFETKGTYGYGNAIWPKEDGFGNEKEDDFVQPTELMNRPWRPLTRKLKILAAVLSPYRLIIFIRLVVLALFLAWRIKHQNTDAVWLWGMSVVCEIWFAFSWLLDQLPKLCPVNRSTDLNVLGDFNSIRSQDERTGSS







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo