SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g36571): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g36571): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g36571

Feature Type:gene_model
Chromosome:Gm06
Start:38818709
stop:38819632
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G21260AT Annotation by Michelle Graham. TAIR10: Glycolipid transfer protein (GLTP) family protein | chr3:7464132-7465785 REVERSE LENGTH=233 SoyBaseE_val: 2.00E-41ISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0046836GO-bp Annotation by Michelle Graham. GO Biological Process: glycolipid transport SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0017089GO-mf Annotation by Michelle Graham. GO Molecular Function: glycolipid transporter activity SoyBaseN/AISS
GO:0051861GO-mf Annotation by Michelle Graham. GO Molecular Function: glycolipid binding SoyBaseN/AISS
PTHR10219Panther GLYCOLIPID TRANSFER PROTEIN-RELATED JGI ISS
PTHR10219:SF4Panther HET-C JGI ISS
PF08718PFAM Glycolipid transfer protein (GLTP) JGI ISS
UniRef100_G7J671UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pleckstrin homology domain-containing protein n=1 Tax=Medicago truncatula RepID=G7J671_MEDTR SoyBaseE_val: 2.00E-67ISS
UniRef100_UPI000233A438UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A438 related cluster n=1 Tax=unknown RepID=UPI000233A438 SoyBaseE_val: 4.00E-95ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g36571 not represented in the dataset

Glyma06g36571 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g239800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g36571.1   sequence type=CDS   gene model=Glyma06g36571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTTTAAGTTCTATATCACTACAGAGGTTGGAAGTGATGCATGAATTGAATCCCTCGATGAATTCAAATTTGGTTGAAATATTGAAATCAGAAGCTAACAAAGGCAAAGCAAGGAAGAGGTCTAGTTGTAGTAAAGCCTTTCTTTGGCTCACTAGTTCCCTGGATTTCTCCTCAGCATTATTACAATCACTAGAAAACGATCCTAAAAAGGATTTGGAGCAAATAGTTCAAGAATGTTATGATGCAACCTTGTCACCATGGCATGGATGGATTTCGTCAGCGGCTTTCAGAGTGGCTAAAAAACTAGTGCCATATAGTAAAACTTTCATGGATCTCCTCAAGGAAAAAGATGAAAACTGTGAAACCCTAAAGGACAAAATGCAGATCTTGGTTTCCTTGCTTGTGCCATTTTTTGATGATGTTCATTGTATTCTTGTAAGCTTAATTTTATGCTTCCTAAAATAA

>Glyma06g36571.1   sequence type=predicted peptide   gene model=Glyma06g36571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLLSSISLQRLEVMHELNPSMNSNLVEILKSEANKGKARKRSSCSKAFLWLTSSLDFSSALLQSLENDPKKDLEQIVQECYDATLSPWHGWISSAAFRVAKKLVPYSKTFMDLLKEKDENCETLKDKMQILVSLLVPFFDDVHCILVSLILCFLK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo