SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g36351

Feature Type:gene_model
Chromosome:Gm06
Start:38525590
stop:38533350
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g36351
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G55540AT Annotation by Michelle Graham. TAIR10: Nuclear pore complex protein | chr1:20734759-20743049 REVERSE LENGTH=1816 SoyBaseE_val: 2.00E-73ISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010070GO-bp Annotation by Michelle Graham. GO Biological Process: zygote asymmetric cell division SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_F4I1T6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nuclear pore complex protein n=2 Tax=Arabidopsis thaliana RepID=F4I1T6_ARATH SoyBaseE_val: 1.00E-70ISS
UniRef100_I1MYG1UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MYG1_SOYBN SoyBaseE_val: 1.00E-162ISS

Expression Patterns of Glyma06g36351
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g36351 not represented in the dataset
Glyma06g36351 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g36351 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g36351
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g36351
>Glyma06g36351.1   sequence type=CDS   gene model=Glyma06g36351   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGTCCCTCGAAGAAGATCGAACCCGAAGAGGTCGAAGGAGAAATAATCGGCACCACGGATTACTTCTTCGTGAAAGTTGGCGAGGCCCTTCCGTTGAAGTCCTCCGACTCCGTTTTCGACGCCGAAACCCTCCCCTCGCAGCCTCTTGCGCTCTCCGAACGCTTTCGCCTCACTTTCGTTGCTCATTCTTCAGGTTTTTTCGTTGCAAAGACGAAGGACCTTATTGATTCCGCGAAGGAGCTTAAGGACAAGGGAAGTGGCTCTCCAGTGGAGCAACTGAGTCTCGTCGATGTTCCTGTTGGGAGGGTTCGCGCATTGGCTCTTTCCACCGATAATTCGACGCTTGCGGCTTCTGTCTCTGGCGACATTCGGTTTTACTCGGTTGAGAGCTTTCTCAATAAGGAAGTGAAGCAATCCTTTTCCTGTTCACTCAACGATTCAACCTTTGTCAAGGACATGCGCTGGATAACAACACCAAAACATTCTTATGTTGTTCTGTCAAACATTGGGAAACTATATTATGGAGACATTGGTTTTCCACTTAAACATGTGATGGACAATGTTGATGCTGTTGATTGGGGTTTGAAAGGTTCATTTGTTGCTGTGGCGAGTAAGAGTGTTCTAAGCATTCTATCGACTAAGTTTGAAGAAAGAGTTTCAATTTCACTATCCTTCAGATCATGGATTGGTGATTTTGCAGCAGATGGTAGCATAAAAGGTTTG
Predicted protein sequences of Glyma06g36351
>Glyma06g36351.1   sequence type=predicted peptide   gene model=Glyma06g36351   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPSKKIEPEEVEGEIIGTTDYFFVKVGEALPLKSSDSVFDAETLPSQPLALSERFRLTFVAHSSGFFVAKTKDLIDSAKELKDKGSGSPVEQLSLVDVPVGRVRALALSTDNSTLAASVSGDIRFYSVESFLNKEVKQSFSCSLNDSTFVKDMRWITTPKHSYVVLSNIGKLYYGDIGFPLKHVMDNVDAVDWGLKGSFVAVASKSVLSILSTKFEERVSISLSFRSWIGDFAADGSIKGL






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo