SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g36290

Feature Type:gene_model
Chromosome:Gm06
Start:38417731
stop:38421607
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g36290
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15290AT Annotation by Michelle Graham. TAIR10: 3-hydroxyacyl-CoA dehydrogenase family protein | chr3:5145054-5146613 FORWARD LENGTH=294 SoyBaseE_val: 7.00E-119ISS
GO:0006631GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid metabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0046685GO-bp Annotation by Michelle Graham. GO Biological Process: response to arsenic-containing substance SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003857GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-hydroxyacyl-CoA dehydrogenase activity SoyBaseN/AISS
GO:0008691GO-mf Annotation by Michelle Graham. GO Molecular Function: 3-hydroxybutyryl-CoA dehydrogenase activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016616GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor SoyBaseN/AISS
GO:0050662GO-mf Annotation by Michelle Graham. GO Molecular Function: coenzyme binding SoyBaseN/AISS
GO:0070403GO-mf Annotation by Michelle Graham. GO Molecular Function: NAD+ binding SoyBaseN/AISS
KOG2304 KOG 3-hydroxyacyl-CoA dehydrogenase JGI ISS
PTHR23309Panther 3-HYDROXYACYL-COA DEHYROGENASE JGI ISS
PF00725PFAM 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain JGI ISS
PF02737PFAM 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain JGI ISS
UniRef100_B0M194UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peroxisomal 3-hydroxyacyl-CoA dehydrogenase-like protein n=1 Tax=Glycine max RepID=B0M194_SOYBN SoyBaseE_val: 2.00E-157ISS
UniRef100_I1KDT4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDT4_SOYBN SoyBaseE_val: 2.00E-170ISS

Expression Patterns of Glyma06g36290
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g36290 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g238900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g36290
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g36290
>Glyma06g36290.2   sequence type=CDS   gene model=Glyma06g36290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTAGAGGTGAAGAGAATCGGTGTGGTGGGGGGTGGCCAAATGGGATCGGGAATAGCCCAAGTCGCTGCCATGCACGACATCGACGCTGCGGGTGCTGATGCTTTGAAACGACTGCGTCTCACGACGGATTTGGAGGATTTACAGCTAGCGGATTTGATCATTGAGGCGATTGTGGAATCCGAAGATGTGAAAAAGAGTTTGTTTGCGCAACTCGATAGGATTGCCAATAGTTCTGCGATTTTGGCGTCCAACACCAGTTCCATTTCCGTCACGCGTCTAGCAACCCCTACCAGCAGGCCATGTCAGGTGATAGGAATGCATTTTATGAATCCACCTCCTGTGATGAAATTGATTGAGATTGTACGAGGTGCAGACACTTCTGAGGAGACATTCGTTGCTACGAAAGCATTGCTGGGCAAGGTAGTGATAACCTCCCATGATTATTCAGGCTTCATACATTTTTTTGCTCTCTACACTGGTGTTGCAACCAAAGAGGATATTGACACAGGAATGAAGCTGGTTACTAACCATCCAATGGGTCCTTTAGAGCTTGCAGACTTCATTGGATTGGATGTGTGCTTGTCAATAATGAGAGTTCTTCATGCTGGCCTTGGTGACAACAAATATGCACCTTGCGCTCTACTTGTGCAGTATGTTGATGCTGGAAGACTCGGAAGAAAACGAGGTATTGGTGTGTATGAATATAGTAAAGATCCAAGGTCTACAAAATCATCTTCCCGTCTCTAA
Predicted protein sequences of Glyma06g36290
>Glyma06g36290.2   sequence type=predicted peptide   gene model=Glyma06g36290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVEVKRIGVVGGGQMGSGIAQVAAMHDIDAAGADALKRLRLTTDLEDLQLADLIIEAIVESEDVKKSLFAQLDRIANSSAILASNTSSISVTRLATPTSRPCQVIGMHFMNPPPVMKLIEIVRGADTSEETFVATKALLGKVVITSHDYSGFIHFFALYTGVATKEDIDTGMKLVTNHPMGPLELADFIGLDVCLSIMRVLHAGLGDNKYAPCALLVQYVDAGRLGRKRGIGVYEYSKDPRSTKSSSRL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo