SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g35786

Feature Type:gene_model
Chromosome:Gm06
Start:37794178
stop:37794522
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g35786
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G61290AT Annotation by Michelle Graham. TAIR10: Flavin-binding monooxygenase family protein | chr5:24648599-24650647 FORWARD LENGTH=461 SoyBaseE_val: 7.00E-38ISS
GO:0006661GO-bp Annotation by Michelle Graham. GO Biological Process: phosphatidylinositol biosynthetic process SoyBaseN/AISS
GO:0042744GO-bp Annotation by Michelle Graham. GO Biological Process: hydrogen peroxide catabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004497GO-mf Annotation by Michelle Graham. GO Molecular Function: monooxygenase activity SoyBaseN/AISS
GO:0004499GO-mf Annotation by Michelle Graham. GO Molecular Function: N,N-dimethylaniline monooxygenase activity SoyBaseN/AISS
GO:0050660GO-mf Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding SoyBaseN/AISS
GO:0050661GO-mf Annotation by Michelle Graham. GO Molecular Function: NADP binding SoyBaseN/AISS
PTHR23023Panther DIMETHYLANILINE MONOOXYGENASE JGI ISS
UniRef100_C6TJC6UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=C6TJC6_SOYBN SoyBaseE_val: 6.00E-56ISS
UniRef100_Q9FLK4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flavin-containing monooxygenase FMO GS-OX-like 8 n=2 Tax=Arabidopsis thaliana RepID=GSXL8_ARATH SoyBaseE_val: 3.00E-35ISS

Expression Patterns of Glyma06g35786
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g35786 not represented in the dataset
Glyma06g35786 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g35786 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g236500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g35786
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g35786
>Glyma06g35786.1   sequence type=CDS   gene model=Glyma06g35786   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTTCGGAAACAAAACAGTCCAAGAGTGTGTGTGTAACTAGAGCTAGACCCTCGGGGCTATTGCTAGCGAGGGTGAGAAAAGAAGGTCACAAGGTGGTTGTGTTGGAGCAAAACCATGATATTGGAGGTCAATGGCTATATGACCCAAATGTACAAGAGGAGGATCCCTTAGGAAGGGACCCTTGGCTAAAGATGCATAGCAACATCTATGAGTCTTTAACGCTCACGTCTCCCAGACAAATCATGGGGTCAACTAATTTCCTCTTTTTAGTCAAGAAAGGTGGAGACACAATGAAGTTTCCAAGCCATACAAAGTTCCTTTCAAGCCATACAGATCATTAG
Predicted protein sequences of Glyma06g35786
>Glyma06g35786.1   sequence type=predicted peptide   gene model=Glyma06g35786   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVSETKQSKSVCVTRARPSGLLLARVRKEGHKVVVLEQNHDIGGQWLYDPNVQEEDPLGRDPWLKMHSNIYESLTLTSPRQIMGSTNFLFLVKKGGDTMKFPSHTKFLSSHTDH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo