Glyma06g35710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g35710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g35710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g35710

Feature Type:	gene_model
Chromosome:	Gm06
Start:	37768273
stop:	37769515
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g35710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G15210	AT	Annotation by Michelle Graham. TAIR10: ethylene responsive element binding factor 4 \| chr3:5121472-5122140 FORWARD LENGTH=222	SoyBase	E_val: 9.00E-47	ISS
GO:0002679	GO-bp	Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009864	GO-bp	Annotation by Michelle Graham. GO Biological Process: induced systemic resistance, jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010105	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010200	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to chitin	SoyBase	N/A	ISS
GO:0035556	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016604	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nuclear body	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_C6T283	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor 6 n=1 Tax=Glycine max RepID=C6T283_SOYBN	SoyBase	E_val: 5.00E-54	ISS
UniRef100_I1KDR5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDR5_SOYBN	SoyBase	E_val: 7.00E-126	ISS

Expression Patterns of Glyma06g35710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g35710 not represented in the dataset	Glyma06g35710 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g35710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g236400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g35710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g35710

Limit To All Plant Sequences

>Glyma06g35710.1   sequence type=CDS   gene model=Glyma06g35710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCAAGGGATATCAATAGATCCAACGTTGTTGTTGTTGCCGGAGTATCCAACCCGACCCATAAAGAGATCCGTTACCGCGGCGTGAGGAAGCGGCCGTGGGGCCGCTACGCCGCCGAGATCCGCGACCCAGGCAAGAAGACACGCGTGTGGCTAGGAACGTTTGACACGGCGGAGGAGGCGGCGCGTGCGTATGACACGGCGGCGCGTGAGTTCCGCGGCACGAAGGCGAAGACCAATTTCCCCACCCACGCGGCGGCGGCGCGTAGTCCCAGCCAGAGCAGCACGCTGGACTCCTCGTCTCCGCCGCCGCTGGACCTTACTCTTGCCGCCCCACTCACCGCCGCGGGCGCGTTGGTTTTCCCGGTGGCGCGTCCCGTGGTGTTCTTCGACGCTTTTGCGCGTGCCGAGGTGCGCGCGTCGTTCGATCTTCCCGTGGCGGGGTTCAGCGACTCGGACTCGTCCTCGGTCGTGGACTACGAGCGGGTCCCACATCGGAAAGTGTTGGATCTTGACCTTAATGTCCCTCCTCCGCCCGAGGTTGCCTGA

Predicted protein sequences of Glyma06g35710

Limit To All Plant Sequences

>Glyma06g35710.1   sequence type=predicted peptide   gene model=Glyma06g35710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPRDINRSNVVVVAGVSNPTHKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGTKAKTNFPTHAAAARSPSQSSTLDSSSPPPLDLTLAAPLTAAGALVFPVARPVVFFDAFARAEVRASFDLPVAGFSDSDSSSVVDYERVPHRKVLDLDLNVPPPPEVA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain