SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g35710

Feature Type:gene_model
Chromosome:Gm06
Start:37768273
stop:37769515
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g35710
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G15210AT Annotation by Michelle Graham. TAIR10: ethylene responsive element binding factor 4 | chr3:5121472-5122140 FORWARD LENGTH=222 SoyBaseE_val: 9.00E-47ISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009864GO-bp Annotation by Michelle Graham. GO Biological Process: induced systemic resistance, jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0010105GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016604GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear body SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00847PFAM AP2 domain JGI ISS
UniRef100_C6T283UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive transcription factor 6 n=1 Tax=Glycine max RepID=C6T283_SOYBN SoyBaseE_val: 5.00E-54ISS
UniRef100_I1KDR5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDR5_SOYBN SoyBaseE_val: 7.00E-126ISS

Expression Patterns of Glyma06g35710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g35710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g236400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g35710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g35710
>Glyma06g35710.1   sequence type=CDS   gene model=Glyma06g35710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCAAGGGATATCAATAGATCCAACGTTGTTGTTGTTGCCGGAGTATCCAACCCGACCCATAAAGAGATCCGTTACCGCGGCGTGAGGAAGCGGCCGTGGGGCCGCTACGCCGCCGAGATCCGCGACCCAGGCAAGAAGACACGCGTGTGGCTAGGAACGTTTGACACGGCGGAGGAGGCGGCGCGTGCGTATGACACGGCGGCGCGTGAGTTCCGCGGCACGAAGGCGAAGACCAATTTCCCCACCCACGCGGCGGCGGCGCGTAGTCCCAGCCAGAGCAGCACGCTGGACTCCTCGTCTCCGCCGCCGCTGGACCTTACTCTTGCCGCCCCACTCACCGCCGCGGGCGCGTTGGTTTTCCCGGTGGCGCGTCCCGTGGTGTTCTTCGACGCTTTTGCGCGTGCCGAGGTGCGCGCGTCGTTCGATCTTCCCGTGGCGGGGTTCAGCGACTCGGACTCGTCCTCGGTCGTGGACTACGAGCGGGTCCCACATCGGAAAGTGTTGGATCTTGACCTTAATGTCCCTCCTCCGCCCGAGGTTGCCTGA
Predicted protein sequences of Glyma06g35710
>Glyma06g35710.1   sequence type=predicted peptide   gene model=Glyma06g35710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPRDINRSNVVVVAGVSNPTHKEIRYRGVRKRPWGRYAAEIRDPGKKTRVWLGTFDTAEEAARAYDTAAREFRGTKAKTNFPTHAAAARSPSQSSTLDSSSPPPLDLTLAAPLTAAGALVFPVARPVVFFDAFARAEVRASFDLPVAGFSDSDSSSVVDYERVPHRKVLDLDLNVPPPPEVA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo