Glyma06g35690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g35690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g35690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g35690

Feature Type:	gene_model
Chromosome:	Gm06
Start:	37717825
stop:	37721035
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g35690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G15190	AT	Annotation by Michelle Graham. TAIR10: chloroplast 30S ribosomal protein S20, putative \| chr3:5116216-5117412 FORWARD LENGTH=202	SoyBase	E_val: 5.00E-56	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0015995	GO-bp	Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process	SoyBase	N/A	ISS
GO:0042254	GO-bp	Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
PF01649	PFAM	Ribosomal protein S20	JGI		ISS
UniRef100_G7LDS2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S20 n=1 Tax=Medicago truncatula RepID=G7LDS2_MEDTR	SoyBase	E_val: 7.00E-82	ISS
UniRef100_I1KDR4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDR4_SOYBN	SoyBase	E_val: 8.00E-125	ISS

Expression Patterns of Glyma06g35690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g35690 not represented in the dataset	Glyma06g35690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g35690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g236200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g35690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g35690

Limit To All Plant Sequences

>Glyma06g35690.1   sequence type=CDS   gene model=Glyma06g35690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCATCAGTTTCATGCTCATGGCTAACTCTTCCGTCCCAAATGAGGAAACTTTCCCTCACATCCTCTTCTTCTTCTCTTTCCATCTCCAATTCTGCTTCTCTCAGTTTCTCCAGAAACCTCTCACACCCTCTCTTCTCACAAGGTAACTGCTTGTCGCTGAGCACAGTGCAGAGGCGCGCGTCTGTGGTCTGCGAGGCTGCGCCGAAAAAGGTGGATTCGGCTGTGAAGAGAGCGCGCCAAGCCGAGAAGCGCCGCGTGTACAACAAAGCTCGGAAATCGGAGATTAAAACACGCACCAAGAAGGTTTTGGAGGCTCTGGAAGTGCTTAAGAAGAAACAAGATGCGCAGGCCGAAGAAATCCTCTCCATTGAGAAGTTGATCGGAGAGGCATACTCGATAATTGACAAAGCTGTGAGAGTAGGCACACTGCACAGGAACACTGGAGCTAATCGCAAGTCTCGGCTTGCTCGAAGAAAGAAGGCAGTGGAGATCCATCATGGCTGGTATACCCCAACTCCTGAAGCCAGTGTCTGA

Predicted protein sequences of Glyma06g35690

Limit To All Plant Sequences

>Glyma06g35690.1   sequence type=predicted peptide   gene model=Glyma06g35690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAASVSCSWLTLPSQMRKLSLTSSSSSLSISNSASLSFSRNLSHPLFSQGNCLSLSTVQRRASVVCEAAPKKVDSAVKRARQAEKRRVYNKARKSEIKTRTKKVLEALEVLKKKQDAQAEEILSIEKLIGEAYSIIDKAVRVGTLHRNTGANRKSRLARRKKAVEIHHGWYTPTPEASV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain