SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g35050

Feature Type:gene_model
Chromosome:Gm06
Start:36823853
stop:36824939
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g35050
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53980AT Annotation by Michelle Graham. TAIR10: homeobox protein 52 | chr5:21914087-21914557 FORWARD LENGTH=156 SoyBaseE_val: 4.00E-37ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PTHR24326Panther FAMILY NOT NAMED JGI ISS
PTHR24326:SF218Panther JGI ISS
PF00046PFAM Homeobox domain JGI ISS
UniRef100_I1KDP7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDP7_SOYBN SoyBaseE_val: 8.00E-147ISS
UniRef100_Q9FN29UniRef Annotation by Michelle Graham. Most informative UniRef hit: Homeobox-leucine zipper protein ATHB-52 n=1 Tax=Arabidopsis thaliana RepID=ATB52_ARATH SoyBaseE_val: 2.00E-34ISS

Expression Patterns of Glyma06g35050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g35050 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g234700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g35050
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g35050
>Glyma06g35050.1   sequence type=CDS   gene model=Glyma06g35050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGATTTCATCTTCTCCTTCAAAACACAACAACAAGAACATCATGCACACCACCAAAGAGCAAAGCATAACAACAACAAGAAGAGGCTAACCGAGGACCAAGTTGCAATTCTCGAGAAGTGCTTTTCCTCCAACATGAAGCTCGAACCGGAGCAGAAGTTCCACCTTGCAAACCAACTTGGTCTGCCTCCAAGACAAGTTGCAATTTGGTACCAAAACAAAAGGGCACGATGGAAGACCCAAAGCCTTGAGGTGGACCATGGTGTGCTTCAGGCAAGGCTAGAGAATGTGGTGGCTGAAAAGAAGCAGCTAGAGAAAGATGTTGAAAGGCTCAAAGCTGAGCTTAAGAAGGCTCAAGAGATGTTGCTTATTACCAATAGTGTCAAAGGTGGAGACCATAATAATAATAATGCTTGTGAATTTTCAACTTCTTTTGAAGAAGGAGGGAGTTCTGGGGTGGTGCTTGATGATGCCACTTATCATCATCATCATGAGTGTTGGCAAAGTGGTGGTGAGGTTATGCAGGTTGAGGAGCTCTATGCTTACTTCGTGGGTGCAAATTATGGGACAGGCTTGCATGAGAAAGGGCATAAAATATAA
Predicted protein sequences of Glyma06g35050
>Glyma06g35050.1   sequence type=predicted peptide   gene model=Glyma06g35050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGDFIFSFKTQQQEHHAHHQRAKHNNNKKRLTEDQVAILEKCFSSNMKLEPEQKFHLANQLGLPPRQVAIWYQNKRARWKTQSLEVDHGVLQARLENVVAEKKQLEKDVERLKAELKKAQEMLLITNSVKGGDHNNNNACEFSTSFEEGGSSGVVLDDATYHHHHECWQSGGEVMQVEELYAYFVGANYGTGLHEKGHKI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo