SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g34871): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g34871): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g34871

Feature Type:gene_model
Chromosome:Gm06
Start:36418742
stop:36419753
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G34450AT Annotation by Michelle Graham. TAIR10: coatomer gamma-2 subunit, putative / gamma-2 coat protein, putative / gamma-2 COP, putative | chr4:16471956-16476795 FORWARD LENGTH=886 SoyBaseE_val: 1.00E-91ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006487GO-bp Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation SoyBaseN/AISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005798GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi-associated vesicle SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0030117GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane coat SoyBaseN/AISS
GO:0030126GO-cc Annotation by Michelle Graham. GO Cellular Compartment: COPI vesicle coat SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0030276GO-mf Annotation by Michelle Graham. GO Molecular Function: clathrin binding SoyBaseN/AISS
PTHR10261Panther COATOMER GAMMA SUBUNIT JGI ISS
PF01602PFAM Adaptin N terminal region JGI ISS
UniRef100_A5BFL2UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5BFL2_VITVI SoyBaseE_val: 3.00E-95ISS
UniRef100_I1K778UniRef Annotation by Michelle Graham. Most informative UniRef hit: Coatomer subunit gamma n=1 Tax=Glycine max RepID=I1K778_SOYBN SoyBaseE_val: 8.00E-95ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g34871 not represented in the dataset

Glyma06g34871 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g233500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g34871.1   sequence type=CDS   gene model=Glyma06g34871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAATTGAAAAGGGGTCTGTTCTTCAGGAGGCAAGGGTTTTTAATGACCCTCAACTAGATGCTAGGAGATGTTCACAAGTTATTACAAAACTCCTATACCTACTTAATCAGGGAGAGACATTTACAAAGGTTAAAGCCACAAAATTTTTCTTTCCTGTGACTAAGCTTTTTCAGTCTAAAGATATGGGATTAAGGAGAATGGTTATCATCGTCACAAGCTCTATCATGAAGGACATGAACAACAAGATTGATATGTATCGAGCAAATTCCATTCTCGTGTTGTGTCGTATCACTGACGGAACCCTCCTTTCACAAATTGAGCGGTATTTAAAACAAGCCATTGTAGATAAAAATCCAGTTGTTGCAAGTGCTGCTCTAGTTAGTGGCATTCATCTGCTCCAAGTAATAGTCATACTAATTTCCTTTTGTAATTCTTTATATATCCTCATATTCATCTATGCTTTTTGCTTATTACGGATGAATCCTGAAATTGTAAAAAGATGGAGCAATGAGGTACAGGAAGTTGTTCAATCAAGAGCAGCCCTTATACAATTTCATGCACTGGGCTTGCTACATCGGGTATACTTCCAAAATTATTTGGCTCTGTATAAGGTTTTTGGTGTATCAAAGCACCTCAAAAATTGGTCATCATTCTAG

>Glyma06g34871.1   sequence type=predicted peptide   gene model=Glyma06g34871   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGIEKGSVLQEARVFNDPQLDARRCSQVITKLLYLLNQGETFTKVKATKFFFPVTKLFQSKDMGLRRMVIIVTSSIMKDMNNKIDMYRANSILVLCRITDGTLLSQIERYLKQAIVDKNPVVASAALVSGIHLLQVIVILISFCNSLYILIFIYAFCLLRMNPEIVKRWSNEVQEVVQSRAALIQFHALGLLHRVYFQNYLALYKVFGVSKHLKNWSSF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo