SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g34225): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g34225): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g34225

Feature Type:gene_model
Chromosome:Gm06
Start:35419616
stop:35421957
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G20580AT Annotation by Michelle Graham. TAIR10: 26S proteasome regulatory subunit S2 1A | chr2:8859211-8864699 FORWARD LENGTH=891 SoyBaseE_val: 1.00E-36ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0030163GO-bp Annotation by Michelle Graham. GO Biological Process: protein catabolic process SoyBaseN/AISS
GO:0042176GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein catabolic process SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0008540GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, base subcomplex SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0030234GO-mf Annotation by Michelle Graham. GO Molecular Function: enzyme regulator activity SoyBaseN/AISS
GO:0043130GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin binding SoyBaseN/AISS
PTHR10943Panther 26S PROTEASOME REGULATORY SUBUNIT JGI ISS
PTHR10943:SF1Panther 26S PROTEASOME REGULATORY SUBUNIT S JGI ISS
UniRef100_B9RVT9UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26S proteasome regulatory subunit rpn1, putative n=1 Tax=Ricinus communis RepID=B9RVT9_RICCO SoyBaseE_val: 2.00E-41ISS
UniRef100_I1KEY6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Papilionoideae RepID=I1KEY6_SOYBN SoyBaseE_val: 2.00E-43ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g34225 not represented in the dataset

Glyma06g34225 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g34225.1   sequence type=CDS   gene model=Glyma06g34225   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCAGAAGCACAATGTTATGTTTTAAGGCAAAAGGGTACGGACAATGTTGAGGCAATTGCCAAAGTTTCAAAGAATTTCAATGAAAAAATTAGAAAGTGTTGTGACATGACAGTACTATCATGTGCCCATGCTGGAACTGGAAATGTTCTCAAGGTTCAAAATTTGTTGGGTCATTGTTCACAACATCTTGATAAAGGTGAAACTCGCCAAAGTCTTGTTGTGCTTGGAATTGCTATGGTAGCTATGGCTAAAGAATTGGGACTTGAGATGGCAATTCGATCATTAGAAAATCTTGTACAATATGGAGAGTAG

>Glyma06g34225.1   sequence type=predicted peptide   gene model=Glyma06g34225   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESEAQCYVLRQKGTDNVEAIAKVSKNFNEKIRKCCDMTVLSCAHAGTGNVLKVQNLLGHCSQHLDKGETRQSLVVLGIAMVAMAKELGLEMAIRSLENLVQYGE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo