Report for Sequence Feature Glyma06g34210
Feature Type: gene_model
Chromosome: Gm06
Start: 35397562
stop: 35398728
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma06g34210
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G45600 AT
Annotation by Michelle Graham. TAIR10: YEATS family protein | chr5:18488059-18489666 FORWARD LENGTH=268
SoyBase E_val: 8.00E-45 ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0010228 GO-bp
Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem
SoyBase N/A ISS
GO:0048510 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of timing of transition from vegetative to reproductive phase
SoyBase N/A ISS
GO:0090239 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of histone H4 acetylation
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
PTHR23195 Panther
YEATS DOMAIN
JGI ISS
PTHR23195:SF15 Panther
SUBFAMILY NOT NAMED
JGI ISS
UniRef100_B9SXM8 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: YEATS domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9SXM8_RICCO
SoyBase E_val: 7.00E-47 ISS
UniRef100_I1J8L7 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1J8L7_SOYBN
SoyBase E_val: 5.00E-51 ISS
Expression Patterns of Glyma06g34210
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma06g34210 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.06g231700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma06g34210
Coding sequences of Glyma06g34210
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma06g34210.1 sequence type=CDS gene model=Glyma06g34210 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTTTCCTTTTTGCTGGTTACTTGGATTTGGGACTTGGGAGATTGCATTTTTTTAATAACATATGTTAATGGATTATGTGGTTATAGGTATCAACATTTGAAATTATATCCAGAAGATGAATATGGCCCCCAGTCTATGAAGAAACCCGTGGTTGTTGAATCTTATAACGAGATTGTTTTCCCTGAACCCTCAGAGGTTTTTCTTGCACGTGTACAAAATCATCCTGCCGTTAATGTGCCTAGGCTTCCTGCTGGTTTGAATTTATCATGTTCTGGTACTTTCCTTTCAATGTTATTCCTATTCCTACTAAGAGGTGACACCAAAGATCATCCTCTAACTCAATGGTTCTTAAACTTCTCTGAGGATGATGAGATCTTAAAACTTGCAGCAGCTCGCCAGCAGCAACAATTTCATCAAGTAGAAGCTAGGCAACAAAGTTCTATGAATCCAGCTTCCTCTTGA
Predicted protein sequences of Glyma06g34210
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma06g34210.1 sequence type=predicted peptide gene model=Glyma06g34210 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVSFLLVTWIWDLGDCIFLITYVNGLCGYRYQHLKLYPEDEYGPQSMKKPVVVESYNEIVFPEPSEVFLARVQNHPAVNVPRLPAGLNLSCSGTFLSMLFLFLLRGDTKDHPLTQWFLNFSEDDEILKLAAARQQQQFHQVEARQQSSMNPASS*