Glyma06g33840 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g33840

Feature Type:	gene_model
Chromosome:	Gm06
Start:	34918111
stop:	34923604
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g33840

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G16890	AT	Annotation by Michelle Graham. TAIR10: ubiquitin-conjugating enzyme 36 \| chr1:5776550-5778327 REVERSE LENGTH=153	SoyBase	E_val: 1.00E-109	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0010039	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to iron ion	SoyBase	N/A	ISS
GO:0010053	GO-bp	Annotation by Michelle Graham. GO Biological Process: root epidermal cell differentiation	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031372	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: UBC13-MMS2 complex	SoyBase	N/A	ISS
GO:0004842	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0016881	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity	SoyBase	N/A	ISS
KOG0417	KOG	Ubiquitin-protein ligase	JGI		ISS
PTHR24067	Panther	UBIQUITIN-CONJUGATING ENZYME E2	JGI		ISS
PTHR24067:SF30	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00179	PFAM	Ubiquitin-conjugating enzyme	JGI		ISS
UniRef100_C6T129	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6T129_SOYBN	SoyBase	E_val: 1.00E-107	ISS
UniRef100_Q9FZ48	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin-conjugating enzyme E2 36 n=2 Tax=Arabidopsis RepID=UBC36_ARATH	SoyBase	E_val: 5.00E-107	ISS

Expression Patterns of Glyma06g33840

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g33840 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g230300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g33840

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma06g33840

Limit To All Plant Sequences

>Glyma06g33840.2   sequence type=transcript   gene model=Glyma06g33840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTTCATTTTAATAGAGTGTTTGCTGATTGAAAATAAAGTTTTTCGATCTCAGCATTGTTCATTTCTGTCTCACTGAGAGAAACTCTCTCTCTCTCTCTCTCTCTCTCTCTAGAAACCCTATTGCACGTTTTGCAATCGAACTCGACAATGGCCAACAGCAACCTCCCTCGAAGAATCATCAAGTCTCTGATATTATGATGATCTGCTGATGCAGCACCTGGTATTAGTGCCTCCCCCTCTGAAGAGAATATGCGATATTTCAATGTGATGATCCTTGGGCCTACCCAGTCGCCTTATGAAGGAGGCGTTTTCAAGTTAGAACTATTTTTGCCAGAAGAATATCCAATGGCTGCTCCAAAGGTTAGGTTTCTAACAAAAATATATCATCCGAACATTGATAAGCTTGGCAGGATATGTCTTGATATTCTGAAAGATAAGTGGAGTCCTGCACTTCAGATACGCACTGTTCTATTAAGCATTCAAGCTCTATTGAGTGCACCAAACCCAGATGATCCACTTTCTGAGAACATTGCCAAGCATTGGAAATCTAATGAGGCCGAGGCTGTCGAAACAGCGAAGGAATGGACCCAATTATATGCTAGTGGCGCCTGATGATAGGCTTCAAACTTATGGCTCCAAAATAACAATTGTAACCATTTTATATTGGAAATCTACAGGAATTTATGTATGAACTATTCGAATTAATATTCCTAGCAGCTTCCAGTTACCTGTTAATTTCTTCTCTTGGAAGCTGCCTTATGTTGGAACTTGTATGAATATATGTGTTGATCATTTACCTATCTAACAATTTAGAACGTGCTTCAGTCGTTGACTGAAGTAATTTGGTATTCTCAACATCAAAGGCCAAAATTTGTGATTTAGTTTCTGTTCTCTTTATCTCAATGAATCAGTCAAAGATTTGATTGGTTATGGCATGGTTGG

Coding sequences of Glyma06g33840

Limit To All Plant Sequences

>Glyma06g33840.1   sequence type=CDS   gene model=Glyma06g33840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAACAGCAACCTCCCTCGAAGAATCATCAAGGAAACGCAGCGTTTGCTCAGTGAGCCAGCACCTGGTATTAGTGCCTCCCCCTCTGAAGAGAATATGCGATATTTCAATGTGATGATCCTTGGGCCTACCCAGTCGCCTTATGAAGGAGGCGTTTTCAAGTTAGAACTATTTTTGCCAGAAGAATATCCAATGGCTGCTCCAAAGGTTAGGTTTCTAACAAAAATATATCATCCGAACATTGATAAGCTTGGCAGGATATGTCTTGATATTCTGAAAGATAAGTGGAGTCCTGCACTTCAGATACGCACTGTTCTATTAAGCATTCAAGCTCTATTGAGTGCACCAAACCCAGATGATCCACTTTCTGAGAACATTGCCAAGCATTGGAAATCTAATGAGGCCGAGGCTGTCGAAACAGCGAAGGAATGGACCCAATTATATGCTAGTGGCGCCTGA

>Glyma06g33840.2   sequence type=CDS   gene model=Glyma06g33840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGATATTTCAATGTGATGATCCTTGGGCCTACCCAGTCGCCTTATGAAGGAGGCGTTTTCAAGTTAGAACTATTTTTGCCAGAAGAATATCCAATGGCTGCTCCAAAGGTTAGGTTTCTAACAAAAATATATCATCCGAACATTGATAAGCTTGGCAGGATATGTCTTGATATTCTGAAAGATAAGTGGAGTCCTGCACTTCAGATACGCACTGTTCTATTAAGCATTCAAGCTCTATTGAGTGCACCAAACCCAGATGATCCACTTTCTGAGAACATTGCCAAGCATTGGAAATCTAATGAGGCCGAGGCTGTCGAAACAGCGAAGGAATGGACCCAATTATATGCTAGTGGCGCCTGA

Predicted protein sequences of Glyma06g33840

Limit To All Plant Sequences

>Glyma06g33840.1   sequence type=predicted peptide   gene model=Glyma06g33840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MANSNLPRRIIKETQRLLSEPAPGISASPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTQLYASGA*

>Glyma06g33840.2   sequence type=predicted peptide   gene model=Glyma06g33840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSENIAKHWKSNEAEAVETAKEWTQLYASGA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain