SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g33611

Feature Type:gene_model
Chromosome:Gm06
Start:34798154
stop:34799891
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g33611
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17250AT Annotation by Michelle Graham. TAIR10: CCAAT-binding factor | chr2:7499573-7502957 FORWARD LENGTH=577 SoyBaseE_val: 2.00E-26ISS
GO:0000478GO-bp Annotation by Michelle Graham. GO Biological Process: endonucleolytic cleavage involved in rRNA processing SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02536PFAM mTERF JGI ISS
UniRef100_G7K1U1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nucleolar complex protein-like protein n=1 Tax=Medicago truncatula RepID=G7K1U1_MEDTR SoyBaseE_val: 1.00E-35ISS
UniRef100_I1KDL6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDL6_SOYBN SoyBaseE_val: 5.00E-80ISS

Expression Patterns of Glyma06g33611
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g33611 not represented in the dataset
Glyma06g33611 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g33611 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g33611
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g33611
>Glyma06g33611.1   sequence type=CDS   gene model=Glyma06g33611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATCCTCCAAGGAAGAAGAAAAAAGGACGATACGACGTCGCAGAGCTGAAAACCCTAGGGAACCAGCTTCTCCTCACCTTCGTTTCCCCTCCTCACCACGTCCTCGAATCCCTCCTCTCGCACCACTCCTTCTTCCTCCCTCTCCTCCCCAAGCTCCCTTCCTCCTCCGCCTCCGCCGCCGCCACCACCGCTCTCTCCGTCGTCGGCGACCAATCCGAGTTCATCTACCTCTCATGGCTCCGTTCCAAGTTCTATGAGTTCCTCAAGTCCCTCTTCAACGTCCTCGCTTCGCCGCAGGGAGATGAGACGCTCAAGGAACTCGTGTTGGACACGCTCATGCAATTCGTAAAGGTCGCCAATGGCGGCGCCTTTCACCCTTCTCAGTACCACAAGCTTCTTCATAGTATTACTTGTCTATACCTTGAGATAGAAAGAACTAAGCTGAAGTCGATGGTGGATCAGTTTGCTGAACTAGGAGTTCGAAACAAAAAGTTAAATCAGTTTATTGCCAAAAGTCCTCAACTACTATTGCGGAAGCCCAAAGACTTTCTACAGATTGTTCTGTTGTTTGAAAATATGGGTTTTGATAAAGAAACCATTGGAACAATACTTGCTCGCTGCCCTGAAATTTTTGCTGCCAGCATTAATAAAACTCTACAAAGGAAGATTGAG
Predicted protein sequences of Glyma06g33611
>Glyma06g33611.1   sequence type=predicted peptide   gene model=Glyma06g33611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDPPRKKKKGRYDVAELKTLGNQLLLTFVSPPHHVLESLLSHHSFFLPLLPKLPSSSASAAATTALSVVGDQSEFIYLSWLRSKFYEFLKSLFNVLASPQGDETLKELVLDTLMQFVKVANGGAFHPSQYHKLLHSITCLYLEIERTKLKSMVDQFAELGVRNKKLNQFIAKSPQLLLRKPKDFLQIVLLFENMGFDKETIGTILARCPEIFAASINKTLQRKIE






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo