Glyma06g32802 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g32802

Feature Type:	gene_model
Chromosome:	Gm06
Start:	33783564
stop:	33783844
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g32802

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG01010	AT	Annotation by Michelle Graham. TAIR10: NADH-Ubiquinone oxidoreductase (complex I), chain 5 protein \| chrC:110398-112638 REVERSE LENGTH=746	SoyBase	E_val: 3.00E-22	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0042773	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled electron transport	SoyBase	N/A	ISS
GO:0045333	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular respiration	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003954	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity	SoyBase	N/A	ISS
GO:0008137	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity	SoyBase	N/A	ISS
PF01010	PFAM	NADH-Ubiquinone oxidoreductase (complex I), chain 5 C-terminus	JGI		ISS
UniRef100_Q2PMM9	UniRef	Annotation by Michelle Graham. Best UniRef hit: NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic n=1 Tax=Glycine max RepID=NU5C_SOYBN	SoyBase	E_val: 4.00E-31	ISS
UniRef100_Q2PMM9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic n=1 Tax=Glycine max RepID=NU5C_SOYBN	SoyBase	E_val: 4.00E-31	ISS

Expression Patterns of Glyma06g32802

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g32802 not represented in the dataset	Glyma06g32802 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g32802 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g32802

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g32802

Limit To All Plant Sequences

>Glyma06g32802.1   sequence type=CDS   gene model=Glyma06g32802   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCGATTTTCTATCCTTGTTTTAGTGCTCTTTACTTTATTCGTTGGGACCATAGGAATTTCTTTTAGCTACAAAGGAATAAATTTGGATATATTATCAAAATGGTTAATTCCCTTTATAGACCTTTTACATAAAAATTCAAAAAATTTTGTGGATTGGTATGAATTTTTGACCAACACAACTTTTTCGGTGATTCAGTGTTGGAGGAGATGA

Predicted protein sequences of Glyma06g32802

Limit To All Plant Sequences

>Glyma06g32802.1   sequence type=predicted peptide   gene model=Glyma06g32802   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRFSILVLVLFTLFVGTIGISFSYKGINLDILSKWLIPFIDLLHKNSKNFVDWYEFLTNTTFSVIQCWRR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain