SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g32710

Feature Type:gene_model
Chromosome:Gm06
Start:33578187
stop:33578449
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Expression Patterns of Glyma06g32710
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g32710 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g32710
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g32710
>Glyma06g32710.1   sequence type=CDS   gene model=Glyma06g32710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCACGAGGACCTCCCCTCAGCCTGATCAGTCACTTATGACACCAACGTTTGGTTTGATTTGCCCACCTACCTTGTACCATGTCAAGCATAGTCCTAGAAAAGGAGCATCAATCAAATCAGTCTTCTGTTAA
Predicted protein sequences of Glyma06g32710
>Glyma06g32710.1   sequence type=predicted peptide   gene model=Glyma06g32710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTTRTSPQPDQSLMTPTFGLICPPTLYHVKHSPRKGASIKSVFC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo