Glyma06g32693 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g32693

Feature Type:	gene_model
Chromosome:	Gm06
Start:	33520999
stop:	33523900
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g32693

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G14690	AT	Annotation by Michelle Graham. TAIR10: cytochrome P450, family 72, subfamily A, polypeptide 15 \| chr3:4937410-4939310 FORWARD LENGTH=512	SoyBase	E_val: 8.00E-50	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0016705	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	SoyBase	N/A	ISS
GO:0019825	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxygen binding	SoyBase	N/A	ISS
GO:0020037	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme binding	SoyBase	N/A	ISS
PTHR25943	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR25943:SF174	Panther		JGI		ISS
PF00067	PFAM	Cytochrome P450	JGI		ISS
UniRef100_H2DH21	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 CYP72A129 n=1 Tax=Panax ginseng RepID=H2DH21_PANGI	SoyBase	E_val: 2.00E-55	ISS
UniRef100_I1KDK0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDK0_SOYBN	SoyBase	E_val: 1.00E-114	ISS

Expression Patterns of Glyma06g32693

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g32693 not represented in the dataset	Glyma06g32693 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g32693 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g227400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g32693

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g32693

Limit To All Plant Sequences

>Glyma06g32693.1   sequence type=CDS   gene model=Glyma06g32693   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTTGATGCAACAACGATGATGTTTGTTGGATTTTGTATTGCATTTGTTACCATACTCCTAACGAAAGCACTGAGTTGGCTGTGGCTGGAGCCAAAAAGGGCAGAGAGGTACCTTAGAAGACAAGGCTTAAAGGGAAACTCATACACACTTTTCTTTGGAGACATCAAAGCAATTTCTACGTTGATACAGAAAGCAAAATCTAAGCCCATAGACATCAACGATGATGTTACTCCTCGCCTAGTTCCATTTCAACATCAACTGATAAGAAATTATGGTAAGAATTCGTTTTTTTGGTATGGCCCGAAGCCTGTAGTGCATATTATGGATCCTGAAGCAATAAGAGAGGTTCTCAATTTGATAAATGACTTTCCAAAGCCGACCTTAACTCCACTTTCCAAGTTCCTGATAACCGGACTTGTAGACCTTGATGGTGATAAATGGTCAAAGCACAGAAAGATCATCAACCCTGCATTTAATCTCGCGAAGCTAAAGGTTTTTTTTTCTCATTATATATTGTGCCAATCTCTAACTTTAAATTTTATTATATATTATTGA

Predicted protein sequences of Glyma06g32693

Limit To All Plant Sequences

>Glyma06g32693.1   sequence type=predicted peptide   gene model=Glyma06g32693   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVDATTMMFVGFCIAFVTILLTKALSWLWLEPKRAERYLRRQGLKGNSYTLFFGDIKAISTLIQKAKSKPIDINDDVTPRLVPFQHQLIRNYGKNSFFWYGPKPVVHIMDPEAIREVLNLINDFPKPTLTPLSKFLITGLVDLDGDKWSKHRKIINPAFNLAKLKVFFSHYILCQSLTLNFIIYY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain