SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g32480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g32480): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g32480

Feature Type:gene_model
Chromosome:Gm06
Start:33287986
stop:33289254
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g32480
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17100AT Annotation by Michelle Graham. TAIR10: SOUL heme-binding family protein | chr1:5844766-5845539 FORWARD LENGTH=232 SoyBaseE_val: 3.00E-63ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PTHR11220Panther HEME-BINDING PROTEIN-RELATED JGI ISS
PTHR11220:SF4Panther HEME-BINDING PROTEIN-RELATED JGI ISS
PF04832PFAM SOUL heme-binding protein JGI ISS
UniRef100_E4MVM7UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-06-F15 n=1 Tax=Eutrema halophilum RepID=E4MVM7_THEHA SoyBaseE_val: 1.00E-61ISS
UniRef100_I1KDJ6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KDJ6_SOYBN SoyBaseE_val: 2.00E-137ISS

Expression Patterns of Glyma06g32480
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g32480 not represented in the dataset
Glyma06g32480 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g32480 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g227000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g32480
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g32480
>Glyma06g32480.2   sequence type=CDS   gene model=Glyma06g32480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCTAGTTCCACATTGCAATTCCCAATTCTCTTGGGTCTTCTCTTAATTTCATTTCTGGGTGTTGAAGGGGTACTTCCCCCATCATGCAATCGCTATGAGTGCCCCAACTATAATGTCAAATATGTAGGCAAAAACTTTGAAATCCGTCGTTATAATTCACCTGTGTGGATTTCAAATCTGGCTGTTCAAGACCCTTCTTTGGTTGGAGCTACAAGATCTGGCTTCAAAAGACTATTTAGTTATATTTATGGTAACAACAACTATAAGAAGGAAATGAACATGACAACGCCTGTGATCAGTGAAGTATCAATTAATGGTGGAAATTCCTCAATTGTTGTGAGCTTCTATGTGCCGAAAGTGAACCAAGCAGACCCACCTTTGGCAAATGGTCTCTATGTTCAGAGATGGAAAACTATAGATGTAGCAGTAAGACAATTTGGTGGATTTGTCAAAGATTCTAATATTGGGTTGCAAGTGTCGGCCTTGAACGATAGTCTTACCGGCACTACATGGTCCGCTATTGTTAAGAATAAGTACATTGTGGCACAGTACAATTCCCCTTTTGAATTGTACAATAGAGTGAATGAGATATGGTTTTTTTATGAATGA
Predicted protein sequences of Glyma06g32480
>Glyma06g32480.2   sequence type=predicted peptide   gene model=Glyma06g32480   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPSSTLQFPILLGLLLISFLGVEGVLPPSCNRYECPNYNVKYVGKNFEIRRYNSPVWISNLAVQDPSLVGATRSGFKRLFSYIYGNNNYKKEMNMTTPVISEVSINGGNSSIVVSFYVPKVNQADPPLANGLYVQRWKTIDVAVRQFGGFVKDSNIGLQVSALNDSLTGTTWSAIVKNKYIVAQYNSPFELYNRVNEIWFFYE*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo