Glyma06g31606 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g31606): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g31606): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g31606

Feature Type:	gene_model
Chromosome:	Gm06
Start:	31975843
stop:	31978716
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g31606

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G52060	AT	Annotation by Michelle Graham. TAIR10: BCL-2-associated athanogene 1 \| chr5:21152449-21153741 REVERSE LENGTH=342	SoyBase	E_val: 1.00E-23	ISS
GO:0006833	GO-bp	Annotation by Michelle Graham. GO Biological Process: water transport	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0051087	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chaperone binding	SoyBase	N/A	ISS
PF02179	PFAM	BAG domain	JGI		ISS
UniRef100_C6T9X9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T9X9_SOYBN	SoyBase	E_val: 1.00E-55	ISS
UniRef100_Q0WUQ1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BAG family molecular chaperone regulator 1 n=1 Tax=Arabidopsis thaliana RepID=BAG1_ARATH	SoyBase	E_val: 5.00E-21	ISS

Expression Patterns of Glyma06g31606

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g31606 not represented in the dataset	Glyma06g31606 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g31606 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g226500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g31606

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g31606

Limit To All Plant Sequences

>Glyma06g31606.1   sequence type=CDS   gene model=Glyma06g31606   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCAAAGATGGATCAAAATTGGAGCTGCTTGTGGACATTGAGAGTAGAGAAAGAAGGATACTTGAGACGTTAAAAATTGCTAAGAAGGAGAAGACATTAAAATCCTTGACAGAAATAAAGGGGGAGGTTGATAAACTTGCCAAGAATGTAGCAGCTTTGGAAGCTGCTACTTCCACAGGTGGGGTTATAGCAGAGTTAGATATACAGACCTTGACAGAGAATTTGATGAGAACATTGATTGCATTGGATGAAATTTATGGTGAGGGTGAACTGAAATTGCAGAGAAGAAAGCAGATTAGGAGAGTTCAACAAACACATTGA

Predicted protein sequences of Glyma06g31606

Limit To All Plant Sequences

>Glyma06g31606.1   sequence type=predicted peptide   gene model=Glyma06g31606   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKDGSKLELLVDIESRERRILETLKIAKKEKTLKSLTEIKGEVDKLAKNVAALEAATSTGGVIAELDIQTLTENLMRTLIALDEIYGEGELKLQRRKQIRRVQQTH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain