SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g31583): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g31583): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g31583

Feature Type:gene_model
Chromosome:Gm06
Start:31941345
stop:31943348
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g31583
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G16120AT Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein | chr5:5265820-5267775 FORWARD LENGTH=369 SoyBaseE_val: 1.00E-13ISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
PTHR11614Panther PHOSPHOLIPASE-RELATED JGI ISS
PTHR11614:SF20Panther LYSOPHOSPHOLIPASE JGI ISS
UniRef100_G7KN38UniRef Annotation by Michelle Graham. Most informative UniRef hit: Monoglyceride lipase n=2 Tax=Medicago truncatula RepID=G7KN38_MEDTR SoyBaseE_val: 8.00E-18ISS
UniRef100_I1L4C4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L4C4_SOYBN SoyBaseE_val: 4.00E-20ISS

Expression Patterns of Glyma06g31583
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g31583 not represented in the dataset
Glyma06g31583 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g31583 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g31583
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g31583
>Glyma06g31583.1   sequence type=CDS   gene model=Glyma06g31583   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATCATATACCTCATCCGTTTAAAAATAAAATCAATTACTCGAAGCTTAAGAACAAAAGAAGTATATATCAAGATGTACCAAGCTTCTTGTTGGGTGAATCAATGGGTGGAGCCATTGATTTGAATATTCACTTCAAACAACCTGCTGCATGGAATGGTGCTGCTCTTATTGCACCTTTGTGCAAGGATAGTTCATGA
Predicted protein sequences of Glyma06g31583
>Glyma06g31583.1   sequence type=predicted peptide   gene model=Glyma06g31583   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHHIPHPFKNKINYSKLKNKRSIYQDVPSFLLGESMGGAIDLNIHFKQPAAWNGAALIAPLCKDSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo