Glyma06g28630 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g28630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g28630): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g28630

Feature Type:	gene_model
Chromosome:	Gm06
Start:	27167556
stop:	27168151
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g28630

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G75680	AT	Annotation by Michelle Graham. TAIR10: glycosyl hydrolase 9B7 \| chr1:28417215-28419231 REVERSE LENGTH=525	SoyBase	E_val: 3.00E-43	ISS
GO:0000271	GO-bp	Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0000272	GO-bp	Annotation by Michelle Graham. GO Biological Process: polysaccharide catabolic process	SoyBase	N/A	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0005982	GO-bp	Annotation by Michelle Graham. GO Biological Process: starch metabolic process	SoyBase	N/A	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0007389	GO-bp	Annotation by Michelle Graham. GO Biological Process: pattern specification process	SoyBase	N/A	ISS
GO:0008361	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of cell size	SoyBase	N/A	ISS
GO:0009664	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization	SoyBase	N/A	ISS
GO:0009736	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway	SoyBase	N/A	ISS
GO:0009825	GO-bp	Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth	SoyBase	N/A	ISS
GO:0009832	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis	SoyBase	N/A	ISS
GO:0009926	GO-bp	Annotation by Michelle Graham. GO Biological Process: auxin polar transport	SoyBase	N/A	ISS
GO:0009932	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell tip growth	SoyBase	N/A	ISS
GO:0010015	GO-bp	Annotation by Michelle Graham. GO Biological Process: root morphogenesis	SoyBase	N/A	ISS
GO:0010075	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth	SoyBase	N/A	ISS
GO:0010817	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0040007	GO-bp	Annotation by Michelle Graham. GO Biological Process: growth	SoyBase	N/A	ISS
GO:0042546	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis	SoyBase	N/A	ISS
GO:0043481	GO-bp	Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light	SoyBase	N/A	ISS
GO:0048653	GO-bp	Annotation by Michelle Graham. GO Biological Process: anther development	SoyBase	N/A	ISS
GO:0048767	GO-bp	Annotation by Michelle Graham. GO Biological Process: root hair elongation	SoyBase	N/A	ISS
GO:0071555	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall organization	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004553	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds	SoyBase	N/A	ISS
PTHR22298	Panther	ENDO-1,4-BETA-GLUCANASE	JGI		ISS
PF00759	PFAM	Glycosyl hydrolase family 9	JGI		ISS
UniRef100_G7J4Q1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Endoglucanase n=1 Tax=Medicago truncatula RepID=G7J4Q1_MEDTR	SoyBase	E_val: 1.00E-46	ISS
UniRef100_I1K7K4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K7K4_SOYBN	SoyBase	E_val: 3.00E-56	ISS

Expression Patterns of Glyma06g28630

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g28630 not represented in the dataset	Glyma06g28630 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g28630 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g28630

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g28630

Limit To All Plant Sequences

>Glyma06g28630.1   sequence type=CDS   gene model=Glyma06g28630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CCGTCACTGCCATTGTTTTTACCGTTAAGAAGAAATTTAGTCACTGCGGTTCCGATAAGCCTGCTCCAGTTCCCGGTCCCCCTGGCGCCGTTGACCAAAAATACCGCACTGCACTCAAAACCGCAATGCAATTCTTCGATGTTTAGAAATGCATTTATTTTATTTCCCCTGAAATATGCTGGGAGGTTAGTTGACAATAAAATATCTTGGAGAGGGAATTCGGCTCTTAAGGATGGGAGCCAAGCGAAGTTGGATCTATCAAAAGGGATGTATGATGTTGGGGATAACATGAAGTTTGGTTTTTCGATGGCTTTTACAGCCACGGTGCAGTCTTGGTCCATTCTGGAATATGGAGATCAAATGGATCACGTTGGCCAGTTAGACGCCGCTCAGTATTCGCTCAAGTGGATCACTGATTTTCTCATCAATGCTCACCCTTCTGAGAATGTTCTTTATATTCAG

Predicted protein sequences of Glyma06g28630

Limit To All Plant Sequences

>Glyma06g28630.1   sequence type=predicted peptide   gene model=Glyma06g28630   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
PSLPLFLPLRRNLVTAVPISLLQFPVPLAPLTKNTALHSKPQCNSSMFRNAFILFPLKYAGRLVDNKISWRGNSALKDGSQAKLDLSKGMYDVGDNMKFGFSMAFTATVQSWSILEYGDQMDHVGQLDAAQYSLKWITDFLINAHPSENVLYIQ

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain