SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g26370

Feature Type:gene_model
Chromosome:Gm06
Start:24221484
stop:24224455
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G31200AT Annotation by Michelle Graham. TAIR10: phloem protein 2-A9 | chr1:11146923-11147678 REVERSE LENGTH=180 SoyBaseE_val: 5.00E-32ISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
UniRef100_C6SW81UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SW81_SOYBN SoyBaseE_val: 1.00E-113ISS
UniRef100_Q9XG10UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lectin n=1 Tax=Glycine max RepID=Q9XG10_SOYBN SoyBaseE_val: 1.00E-111ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g221100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g26370.1   sequence type=CDS   gene model=Glyma06g26370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTTTCAAGAAGCCTCATCACACCTCAGACAAGAACTACATAACAGGGGACGACGGAGGCAAGTTCGAGATACAACCTAGAGGACTCAACATTGTGTGGGGAAATGATTCTCGATACTGGAAAATTCCAGAACAAGGTCCTGCGGAGCTGATCCAAGTTTCATGGTTGGAGGTATCCGGCGTGGTAAACTTACCAGGTGTCAAGAAATATAGGGTTGAATTCGAAGTGAGAGTTAAAGACGATGGGTTCGGTTGGAGTGGCACGGACGTGCTAGTGATGGCTAAGATTGGGAAAACGGGAAAATATACGTATAAGGTGACGAAACTAAACCCTGGTGAAACCTTGAATATTCCAAAATCAACTGACCCACTTGAGATTCAAGTGAACAAGCAATCTGAGGACCTTCACTTTGGATTATATGAAGTGTGGAGCGGAAAATGGAAGGGAGGCCTTGAAATTGTCAGAGCCCTCATCAAACCTTTAACTTAA

>Glyma06g26370.1   sequence type=predicted peptide   gene model=Glyma06g26370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPFKKPHHTSDKNYITGDDGGKFEIQPRGLNIVWGNDSRYWKIPEQGPAELIQVSWLEVSGVVNLPGVKKYRVEFEVRVKDDGFGWSGTDVLVMAKIGKTGKYTYKVTKLNPGETLNIPKSTDPLEIQVNKQSEDLHFGLYEVWSGKWKGGLEIVRALIKPLT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo