|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G77510 | AT | Annotation by Michelle Graham. TAIR10: PDI-like 1-2 | chr1:29126742-29129433 FORWARD LENGTH=508 | SoyBase | E_val: 2.00E-16 | ISS |
| GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
| GO:0006662 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycerol ether metabolic process | SoyBase | N/A | ISS |
| GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
| GO:0009627 | GO-bp | Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance | SoyBase | N/A | ISS |
| GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0034976 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress | SoyBase | N/A | ISS |
| GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
| GO:0045454 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003756 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| GO:0015035 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity | SoyBase | N/A | ISS |
| GO:0016853 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: isomerase activity | SoyBase | N/A | ISS |
| UniRef100_B1Q2X4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide isomerase n=1 Tax=Glycine max RepID=B1Q2X4_SOYBN | SoyBase | E_val: 9.00E-24 | ISS |
| UniRef100_I1KAB7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KAB7_SOYBN | SoyBase | E_val: 8.00E-25 | ISS |
|
Glyma06g26252 not represented in the dataset |
Glyma06g26252 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g218800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g26252.1 sequence type=CDS gene model=Glyma06g26252 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTTTCAAGTTGGAGTTTTTCTGTAGAGGAGTTTGACAACTTTTCTGCCTTAGCAGAGAAGTTGCATTCTGATTATGACTTTGGTCACCCTCTAAATGTCAAACTCCTTCCAAGAGGAGAGTCATCAGTTTCCGGGCCCATAGTTAGGCTCTCCAAGCCATTCACTGGACTTTTTGTTGACTTCCAGGTCTTCCTATGCATTTTAGACTTTTCCAGTTTTTGTTTCTTCCCATCATATTCAATGTCGAGTCTATCGACGAAGAAGCATCGAGCAGGCAAGTCTTTTCCCCTTTTGCTGTTATGCATGTTTGTTTCATTACTATTTGTTTCTATTTGCAAGGTTTTAATTTTGTTTGTTGTTATGCATGTTTTTTTGTGA
>Glyma06g26252.1 sequence type=predicted peptide gene model=Glyma06g26252 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFSSWSFSVEEFDNFSALAEKLHSDYDFGHPLNVKLLPRGESSVSGPIVRLSKPFTGLFVDFQVFLCILDFSSFCFFPSYSMSSLSTKKHRAGKSFPLLLLCMFVSLLFVSICKVLILFVVMHVFL*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||