Glyma06g25670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g25670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g25670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g25670

Feature Type:	gene_model
Chromosome:	Gm06
Start:	23435464
stop:	23436443
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g25670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G21160	AT	Annotation by Michelle Graham. TAIR10: Calcium-dependent ARF-type GTPase activating protein family \| chr4:11284694-11286532 FORWARD LENGTH=337	SoyBase	E_val: 2.00E-32	ISS
GO:0000902	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell morphogenesis	SoyBase	N/A	ISS
GO:0006605	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting	SoyBase	N/A	ISS
GO:0006623	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0016197	GO-bp	Annotation by Michelle Graham. GO Biological Process: endosomal transport	SoyBase	N/A	ISS
GO:0048193	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005543	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phospholipid binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR23180	Panther	CENTAURIN/ARF	JGI		ISS
PTHR23180:SF24	Panther	CENTAURIN/ARF-RELATED	JGI		ISS
UniRef100_G7IKU9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ZAC n=2 Tax=Medicago truncatula RepID=G7IKU9_MEDTR	SoyBase	E_val: 3.00E-38	ISS
UniRef100_UPI0002339CDF	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339CDF related cluster n=1 Tax=unknown RepID=UPI0002339CDF	SoyBase	E_val: 9.00E-57	ISS

Expression Patterns of Glyma06g25670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g25670 not represented in the dataset	Glyma06g25670 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g25670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g25670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g25670

Limit To All Plant Sequences

>Glyma06g25670.1   sequence type=CDS   gene model=Glyma06g25670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTTTGTCTGTGACATTGAATGGATGGTCAAGTTATGGAATAAATGCAACGATTGAAGTTGGAGGAAATTCTTCTGCTAATTCAATTTATGAGGCTAATTTTCTAGAAGGATATACAAAACCTAGACCAGATGCCAGTCATGAGCAGCGTGCGAAATTCATCCGATTAGATATGTTAAAGTATGAGTGTCAAGAATTTTATACTTTATGGATAGTTTTCGAATTACTAGTGATTCATAGCATATGGAAAGCCTTCTATCACTTGTTGCATGCATCCAACCTTACTAGTTTGGTAGAAGGAAAGGTAGAATTTATTGGAATGTTAAAGGCGAAAGTGATCAAAGGCACAAATTTAGTTGTCAGAGATACGATGACAAGTGATCCATATGTTATCTTGGCCAAC

Predicted protein sequences of Glyma06g25670

Limit To All Plant Sequences

>Glyma06g25670.1   sequence type=predicted peptide   gene model=Glyma06g25670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VLSVTLNGWSSYGINATIEVGGNSSANSIYEANFLEGYTKPRPDASHEQRAKFIRLDMLKYECQEFYTLWIVFELLVIHSIWKAFYHLLHASNLTSLVEGKVEFIGMLKAKVIKGTNLVVRDTMTSDPYVILAN

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain