Glyma06g25660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g25660

Feature Type:	gene_model
Chromosome:	Gm06
Start:	23431537
stop:	23433494
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g25660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G27740	AT	Annotation by Michelle Graham. TAIR10: carbamoyl phosphate synthetase A \| chr3:10281470-10283792 REVERSE LENGTH=430	SoyBase	E_val: 3.00E-33	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006164	GO-bp	Annotation by Michelle Graham. GO Biological Process: purine nucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0006543	GO-bp	Annotation by Michelle Graham. GO Biological Process: glutamine catabolic process	SoyBase	N/A	ISS
GO:0009220	GO-bp	Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0070409	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbamoyl phosphate biosynthetic process	SoyBase	N/A	ISS
GO:0005951	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: carbamoyl-phosphate synthase complex	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0004088	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity	SoyBase	N/A	ISS
PTHR11405	Panther	CARBAMOYLTRANSFERASE RELATED	JGI		ISS
PTHR11405:SF4	Panther	CARBAMOYL-PHOSPHATE SYNTHASE, SMALL CHAIN-RELATED	JGI		ISS
PF00988	PFAM	Carbamoyl-phosphate synthase small chain, CPSase domain	JGI		ISS
UniRef100_B9V283	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plastid carbamoylphosphate synthetase small subunit 2 n=1 Tax=Medicago truncatula RepID=B9V283_MEDTR	SoyBase	E_val: 5.00E-44	ISS
UniRef100_C6TER7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TER7_SOYBN	SoyBase	E_val: 3.00E-53	ISS

Expression Patterns of Glyma06g25660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g25660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g25660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g25660

Limit To All Plant Sequences

>Glyma06g25660.1   sequence type=CDS   gene model=Glyma06g25660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGAAAAAAGCTTTGTCCTTCTCTCTGCCTTCCAGTGACCTCACCAACAACCACTTTTCTTCCAAAACGCCACACGCTGTCGCCAAAGGTAGTGGAGAGAGGCCTTGGAAGAATTCAGTTGCTAGACTTATGCTTGAAGATGGTTCAATTTGGAGAGCAAAATCATTTGGAATCTTGGGATATGAGTTTCTTTTGAATGGCTTTACTTGCATGCTGAATATGTGGCAGTATCAAGAAATTTTGACAGATCCTAGTTATGTTAGCCAATTTGTGCTTATGAAAAACCTACATATTGGGAATATTGGCATAATTTTTTTCTTGAATCAACATGGTTTGAAGCCATTTGAAAAACTGTATTTTTGTTCACTTTTTCCAAATGATGAGGAATCAATACAATGTTTCCTTGTTGAGCTTGTAATTAGAAGTTTGAGTATCAGATGTAAGAAGACTTTGGGGGATTACCTAGCTGAAAGGAATATAATGGGAATTTGTGGCGAGTTATCTCGGTCACATGTGAGTGTTGTGGAAGGGGTGTTTGAAGGAAAGTGGCAGGGATGTAGTATGGAAGACATTTATTTT

Predicted protein sequences of Glyma06g25660

Limit To All Plant Sequences

>Glyma06g25660.1   sequence type=predicted peptide   gene model=Glyma06g25660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKKALSFSLPSSDLTNNHFSSKTPHAVAKGSGERPWKNSVARLMLEDGSIWRAKSFGILGYEFLLNGFTCMLNMWQYQEILTDPSYVSQFVLMKNLHIGNIGIIFFLNQHGLKPFEKLYFCSLFPNDEESIQCFLVELVIRSLSIRCKKTLGDYLAERNIMGICGELSRSHVSVVEGVFEGKWQGCSMEDIYF

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain