SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g25380

Feature Type:gene_model
Chromosome:Gm06
Start:23241036
stop:23241305
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g25380
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G20200AT Annotation by Michelle Graham. TAIR10: nucleoporin-related | chr5:6816776-6821620 FORWARD LENGTH=762 SoyBaseE_val: 3.00E-16ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_UPI0002339CD9UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339CD9 related cluster n=1 Tax=unknown RepID=UPI0002339CD9 SoyBaseE_val: 2.00E-52ISS

Expression Patterns of Glyma06g25380
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g25380 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g25380
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g25380
>Glyma06g25380.1   sequence type=CDS   gene model=Glyma06g25380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCACCGATCAAATCACCGCGTCGGCGCCCTCGGAGAGAGGCGCCGGAGGCAAACTCCGAAAACCGCCGCCGAGAAAGCCGCTTCCTAGCCCTTACTCGCGTCCGCCGGAGGCCACCCGCCGCCGTTGGATTTCGAAGCTCGTGGATCCTGCCTATCGCCTCATCGCCGGCGGAGCCACTCGTATTCTCCCCTCTTTCTTCTCCGCCACCGCTGCCGCGCCTCCTCCCTCTCTTCTCCCTTGCCCTACCTCTGCCGCCGAAGATCAA
Predicted protein sequences of Glyma06g25380
>Glyma06g25380.1   sequence type=predicted peptide   gene model=Glyma06g25380   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATDQITASAPSERGAGGKLRKPPPRKPLPSPYSRPPEATRRRWISKLVDPAYRLIAGGATRILPSFFSATAAAPPPSLLPCPTSAAEDQ






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo