Glyma06g24760 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g24760

Feature Type:	gene_model
Chromosome:	Gm06
Start:	22457338
stop:	22459589
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g24760

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G25940	AT	Annotation by Michelle Graham. TAIR10: early nodulin-related \| chr5:9054252-9055151 REVERSE LENGTH=115	SoyBase	E_val: 7.00E-19	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF03386	PFAM	Early nodulin 93 ENOD93 protein	JGI		ISS
UniRef100_Q02921	UniRef	Annotation by Michelle Graham. Best UniRef hit: Early nodulin-93 n=2 Tax=Glycine max RepID=NO93_SOYBN	SoyBase	E_val: 1.00E-67	ISS
UniRef100_Q02921	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin-93 n=2 Tax=Glycine max RepID=NO93_SOYBN	SoyBase	E_val: 1.00E-67	ISS

Expression Patterns of Glyma06g24760

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g24760 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g216500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g24760

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g24760

Limit To All Plant Sequences

>Glyma06g24760.1   sequence type=CDS   gene model=Glyma06g24760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAAGGAAATAGTCCCCTCGAGAGGCCTAGCTTGGCTTCACTTGACCAAAAATTGGCCTTCGCTAAGCGCTGTTCTCATGAGGGTGTGTTAGCGGGAGCAAAGGCAGCAGTTGTTGCCAGTGTTGCCTCTGCCATTCCAACTCTGGCTAGTGTAAGGATGCTGCCTTGGGCAAGAGCCAATCTCAATCACACAGCTCAAGCTCTCATAATTTCCACAGCGACGGCAGCAGCATACTTCATAGTAGCTGACAAGACCGTTTTAGCAACAGCAAGGAAAAACTCCTTCAACCAACCCTCCAATTCTGAAGCATGA

Predicted protein sequences of Glyma06g24760

Limit To All Plant Sequences

>Glyma06g24760.1   sequence type=predicted peptide   gene model=Glyma06g24760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKGNSPLERPSLASLDQKLAFAKRCSHEGVLAGAKAAVVASVASAIPTLASVRMLPWARANLNHTAQALIISTATAAAYFIVADKTVLATARKNSFNQPSNSEA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain