SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g24760

Feature Type:gene_model
Chromosome:Gm06
Start:22457338
stop:22459589
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G25940AT Annotation by Michelle Graham. TAIR10: early nodulin-related | chr5:9054252-9055151 REVERSE LENGTH=115 SoyBaseE_val: 7.00E-19ISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03386PFAM Early nodulin 93 ENOD93 protein JGI ISS
UniRef100_Q02921UniRef Annotation by Michelle Graham. Best UniRef hit: Early nodulin-93 n=2 Tax=Glycine max RepID=NO93_SOYBN SoyBaseE_val: 1.00E-67ISS
UniRef100_Q02921UniRef Annotation by Michelle Graham. Most informative UniRef hit: Early nodulin-93 n=2 Tax=Glycine max RepID=NO93_SOYBN SoyBaseE_val: 1.00E-67ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g216500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g24760.1   sequence type=CDS   gene model=Glyma06g24760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAAAGGAAATAGTCCCCTCGAGAGGCCTAGCTTGGCTTCACTTGACCAAAAATTGGCCTTCGCTAAGCGCTGTTCTCATGAGGGTGTGTTAGCGGGAGCAAAGGCAGCAGTTGTTGCCAGTGTTGCCTCTGCCATTCCAACTCTGGCTAGTGTAAGGATGCTGCCTTGGGCAAGAGCCAATCTCAATCACACAGCTCAAGCTCTCATAATTTCCACAGCGACGGCAGCAGCATACTTCATAGTAGCTGACAAGACCGTTTTAGCAACAGCAAGGAAAAACTCCTTCAACCAACCCTCCAATTCTGAAGCATGA

>Glyma06g24760.1   sequence type=predicted peptide   gene model=Glyma06g24760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAKGNSPLERPSLASLDQKLAFAKRCSHEGVLAGAKAAVVASVASAIPTLASVRMLPWARANLNHTAQALIISTATAAAYFIVADKTVLATARKNSFNQPSNSEA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo