SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g23990

Feature Type:gene_model
Chromosome:Gm06
Start:21458264
stop:21460096
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g23990
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G80840AT Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 40 | chr1:30383834-30385356 FORWARD LENGTH=302 SoyBaseE_val: 4.00E-35ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0002237GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of bacterial origin SoyBaseN/AISS
GO:0002679GO-bp Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009595GO-bp Annotation by Michelle Graham. GO Biological Process: detection of biotic stimulus SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009612GO-bp Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009646GO-bp Annotation by Michelle Graham. GO Biological Process: response to absence of light SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009751GO-bp Annotation by Michelle Graham. GO Biological Process: response to salicylic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0016045GO-bp Annotation by Michelle Graham. GO Biological Process: detection of bacterium SoyBaseN/AISS
GO:0030968GO-bp Annotation by Michelle Graham. GO Biological Process: endoplasmic reticulum unfolded protein response SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0043900GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of multi-organism process SoyBaseN/AISS
GO:0050691GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response to virus by host SoyBaseN/AISS
GO:0050776GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of immune response SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PF03106PFAM WRKY DNA -binding domain JGI ISS
UniRef100_B0LUR8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor n=1 Tax=Glycine max RepID=B0LUR8_SOYBN SoyBaseE_val: 2.00E-72ISS
UniRef100_UPI0002339045UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002339045 related cluster n=1 Tax=unknown RepID=UPI0002339045 SoyBaseE_val: 2.00E-173ISS

Proteins Associated with Glyma06g23990
LocusGene SymbolProtein Name
WRKY102 WRKY Transcription Factor

Expression Patterns of Glyma06g23990
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g23990 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g212900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g23990
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g23990
>Glyma06g23990.2   sequence type=CDS   gene model=Glyma06g23990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTACGGTTTACTTTGGAAACTCTGAGCAGCAAGTGCGAGAAACTTCAATCTCATTTTCAAGAGATCAATAATGAGGAACAAAAAGTGGGCACGAAGTCAGACCAAAGTGGATCAGTATTATTAGCTAGACCCGAGTTTTCGATGGCACAAAAGCCATCACAAATCTTTTTTAAAACCCATCCCAAGGACAATAGTTTGATGGTAAAAGATGGTTATCAGTGGAAGAAGTATGGACAGAAGAAGGTTACCAAAGACAATCCTTCGCCTAGAGCTTATTTCGAGTGCTCCCTGGCTCCTAGCTGCTCAAATTTGAAAAAGGTGCAAAGAAGCATACAGGATAAGTCTATCCTTGTTGCAACTTATGAAGGAAAGCACAACCATGGTGTTTTTCATGATTTACTCAAGCCATCATCTTCTATACCCGAAACCTCAATAATGATTAATAATTTACCTATAACAAACATGCCTAACGACAAAGATACGTTGAACATTGACCTTGCTCTATGTAATTCGGATCAAACAGATATAAGACTTTGTGATGATGTTAAGCAACAGAACCACCGTGGCAGCAAAAGCAAAATTGAAGAATATGTAACTCCTCTAGTTAAAGATCCTGACTTCATCATGCCATTAGCTGAAGCAGTTGCCCACTCCCTCAAGAGCCAGACTTATAAGCAAGTGGGTCTTAACCTGAATTTGGGTCTTCCAGAACCTCATTTGTGA
Predicted protein sequences of Glyma06g23990
>Glyma06g23990.2   sequence type=predicted peptide   gene model=Glyma06g23990   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLRFTLETLSSKCEKLQSHFQEINNEEQKVGTKSDQSGSVLLARPEFSMAQKPSQIFFKTHPKDNSLMVKDGYQWKKYGQKKVTKDNPSPRAYFECSLAPSCSNLKKVQRSIQDKSILVATYEGKHNHGVFHDLLKPSSSIPETSIMINNLPITNMPNDKDTLNIDLALCNSDQTDIRLCDDVKQQNHRGSKSKIEEYVTPLVKDPDFIMPLAEAVAHSLKSQTYKQVGLNLNLGLPEPHL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo