Glyma06g23848 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g23848): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g23848): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g23848

Feature Type:	gene_model
Chromosome:	Gm06
Start:	21151716
stop:	21152421
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g23848

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59840	AT	Annotation by Michelle Graham. TAIR10: Ras-related small GTP-binding family protein \| chr5:24107450-24109049 REVERSE LENGTH=216	SoyBase	E_val: 1.00E-17	ISS
GO:0007264	GO-bp	Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction	SoyBase	N/A	ISS
GO:0015031	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein transport	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0005525	GO-mf	Annotation by Michelle Graham. GO Molecular Function: GTP binding	SoyBase	N/A	ISS
PTHR24073	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24073:SF232	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00071	PFAM	Ras family	JGI		ISS
UniRef100_O49844	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Small GTP-binding protein n=1 Tax=Daucus carota RepID=O49844_DAUCA	SoyBase	E_val: 1.00E-15	ISS
UniRef100_Q8W3J2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Ras-related protein RAB8-5 n=1 Tax=Nicotiana tabacum RepID=Q8W3J2_TOBAC	SoyBase	E_val: 1.00E-15	ISS

Expression Patterns of Glyma06g23848

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g23848 not represented in the dataset	Glyma06g23848 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g23848 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g23848

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g23848

Limit To All Plant Sequences

>Glyma06g23848.1   sequence type=CDS   gene model=Glyma06g23848   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAAACTGGGAGCAGCAGTACATGGGTTTTGGGGAGGAAGACCCTAGTTTTGTGGCTTTTTGTGTGTGTGAGTGTGCTGATTACAATTACCTCATCAAGCTTATTATCGGCGACAACGGTGTGGGGAAGAGTTGTCTACTTTTGAGGTTTTCTGATGGCTCATTCACAACAAGTTTTATCACCACCATTGGGTTAGTATATTATGTGTAG

Predicted protein sequences of Glyma06g23848

Limit To All Plant Sequences

>Glyma06g23848.1   sequence type=predicted peptide   gene model=Glyma06g23848   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MENWEQQYMGFGEEDPSFVAFCVCECADYNYLIKLIIGDNGVGKSCLLLRFSDGSFTTSFITTIGLVYYV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain