SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g23830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g23830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g23830

Feature Type:gene_model
Chromosome:Gm06
Start:21148462
stop:21149730
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g23830
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60450AT Annotation by Michelle Graham. TAIR10: auxin response factor 4 | chr5:24308558-24312187 REVERSE LENGTH=788 SoyBaseE_val: 5.00E-19ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009725GO-bp Annotation by Michelle Graham. GO Biological Process: response to hormone stimulus SoyBaseN/AISS
GO:0010050GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative phase change SoyBaseN/AISS
GO:0010158GO-bp Annotation by Michelle Graham. GO Biological Process: abaxial cell fate specification SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF00171PFAM Aldehyde dehydrogenase family JGI ISS
UniRef100_D7SKV9UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=D7SKV9_VITVI SoyBaseE_val: 4.00E-17ISS
UniRef100_G7JQF5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Auxin response factor n=1 Tax=Medicago truncatula RepID=G7JQF5_MEDTR SoyBaseE_val: 2.00E-16ISS

Expression Patterns of Glyma06g23830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g23830 not represented in the dataset
Glyma06g23830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g23830 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma06g23830
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g23830
>Glyma06g23830.1   sequence type=CDS   gene model=Glyma06g23830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCAGATACCAGCACTCATGTGTGGTTCTCTGTCCCTCGCAACGCTGCTAAGACTGTTTTTCTCGTTTGGTGTGACACCTCACATGATTATAAGCAGCAAAGACCTTCTCAAGAACTTGTTGCCAAAGATTTGCATGAGAAAGTCCTTGTGGTAATTTTTGTCAGGTCAGCCAAGGTGGCATCTGCTCACAGTATTTTTGTTAGCCAAAAGAATCTTGTTTCTGGAGATGCAGTTCTCTTTCTTAGGTGTGTATATGTGTGTGTGTTCAAGAGGCACTTTCCTCAGCACATGAAAAAAATGATGCCTGTAGGGGTTGTAGGTGCAATTACACCTTGGAACTTTCCCCTTGCTATAATTACTCGAAAGGAGTCAGGGAATAACAATCATTTTAAGAATATTTGTTTTCTAATATATCAAGTTGCTGCAGTGGAACTCTCCATTCAAGTTGGAATACCACCGATATTTCCATCATTTTCGGTTGTGATGTTTTGTAATTTAATAATTAAATTTATTAAATATTGTCATTGTAGTATGGAAATTGTACATCAACAGCTTGGTTGTGATGTTTATAGAAAGTTTATTCTGATATTTTAG
Predicted protein sequences of Glyma06g23830
>Glyma06g23830.1   sequence type=predicted peptide   gene model=Glyma06g23830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SDTSTHVWFSVPRNAAKTVFLVWCDTSHDYKQQRPSQELVAKDLHEKVLVVIFVRSAKVASAHSIFVSQKNLVSGDAVLFLRCVYVCVFKRHFPQHMKKMMPVGVVGAITPWNFPLAIITRKESGNNNHFKNICFLIYQVAAVELSIQVGIPPIFPSFSVVMFCNLIIKFIKYCHCSMEIVHQQLGCDVYRKFILIF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo