Glyma06g23090 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g23090

Feature Type:	gene_model
Chromosome:	Gm06
Start:	20121543
stop:	20122876
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g23090

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G18520	AT	Annotation by Michelle Graham. TAIR10: tetraspanin11 \| chr1:6375051-6376178 FORWARD LENGTH=271	SoyBase	E_val: 9.00E-51	ISS
GO:0007568	GO-bp	Annotation by Michelle Graham. GO Biological Process: aging	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG3882	KOG	Tetraspanin family integral membrane protein	JGI		ISS
PTHR19282	Panther	TETRASPANIN	JGI		ISS
PTHR19282:SF137	Panther		JGI		ISS
PF00335	PFAM	Tetraspanin family	JGI		ISS
UniRef100_G7JT30	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Senescence-associated protein n=1 Tax=Medicago truncatula RepID=G7JT30_MEDTR	SoyBase	E_val: 3.00E-84	ISS
UniRef100_I1KD56	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KD56_SOYBN	SoyBase	E_val: 9.00E-151	ISS

Expression Patterns of Glyma06g23090

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g23090

Paralog	Evidence	Comments
Glyma15g25180	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma18g22790	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g23090 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g208300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g23090

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g23090

Limit To All Plant Sequences

>Glyma06g23090.1   sequence type=CDS   gene model=Glyma06g23090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGCCTCCACCTACATCCGTATCCACGGGGACTGCCAGAAGGTGCTCCAGTACCCTCTCCTCTTCGGCGGTCTCTTCATATTCGTTGTTTCCACCCTCGGCCTCATCGGCGCGCTGTGCAGCATCAATGCCGCCATCTACCTCTACCTCCTCGTCACATTCTTCGTCGTCTTAGCCTTCTCCGCCTTCACCATTGTAGCGCTCTTCGTCACCAGAAACAACACGCCGTCATCGGTGCACTACGTCACTGACGAGCGGAACTGGGACGTGGCCAAGAGTTGCTTGCTGCATAAGCTTGTCTGTCACGACGGTAACAATGTGTCTCTTGCTTTCAAACAATTGTCTACCACGCAGTTTGGGTGCTGTAAGCCACCGTTGCAATGTGGATTCACAAAGAAGAACGCTACGTTCTGGGAAGCGCCGGCAAAAGCAAGTACCGCGGCGAACAACACTAATTGCAGAACATGGAGCAACAGACAAGACAAACTGTGTTTCAACTGCGATTCGTGCAAAGGAGGAGTGCTGGCCAACATCAGAAGCCAGTGGAGACATCTCACTATATTCAATGCATGCGTGCTCGTGCTCGTCACCACCATCTACGTCTTGGGCTACTATGCCATCAGGAACAATCGCTTGGAGTACTCCAACTACACCACCCAGAGGAGGAAGATCGGAATGAGAATACCCTCCACAGTAATTTGA

Predicted protein sequences of Glyma06g23090

Limit To All Plant Sequences

>Glyma06g23090.1   sequence type=predicted peptide   gene model=Glyma06g23090   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGASTYIRIHGDCQKVLQYPLLFGGLFIFVVSTLGLIGALCSINAAIYLYLLVTFFVVLAFSAFTIVALFVTRNNTPSSVHYVTDERNWDVAKSCLLHKLVCHDGNNVSLAFKQLSTTQFGCCKPPLQCGFTKKNATFWEAPAKASTAANNTNCRTWSNRQDKLCFNCDSCKGGVLANIRSQWRHLTIFNACVLVLVTTIYVLGYYAIRNNRLEYSNYTTQRRKIGMRIPSTVI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain