Glyma06g23026 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g23026

Feature Type:	gene_model
Chromosome:	Gm06
Start:	20006928
stop:	20007814
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g23026

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G33720	AT	Annotation by Michelle Graham. TAIR10: AP2/B3-like transcriptional factor family protein \| chr2:14263776-14264989 FORWARD LENGTH=326	SoyBase	E_val: 2.00E-24	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
UniRef100_I2FKG1	UniRef	Annotation by Michelle Graham. Best UniRef hit: E1-as protein n=3 Tax=Glycine max RepID=I2FKG1_SOYBN	SoyBase	E_val: 1.00E-127	ISS
UniRef100_I2FKG1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: E1-as protein n=3 Tax=Glycine max RepID=I2FKG1_SOYBN	SoyBase	E_val: 1.00E-127	ISS

Expression Patterns of Glyma06g23026

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g23026 not represented in the dataset	Glyma06g23026 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g23026 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g207800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g23026

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g23026

Limit To All Plant Sequences

>Glyma06g23026.1   sequence type=CDS   gene model=Glyma06g23026   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGAAAGAAAGGGGAAATGTGCCTTCACTTCCATTTCACAAATACACAAAAAAAAAAAAAAATGCTAGTAGTGTAAACACTCAAAACACTCAAATTAAGCCCTTTCAACCTTTCTTTCTTATGAGTTTACAATCTCAAAGCCCATCAAAGTTCACGACCCTATTCATCTCTTCCAACATGAGCAACCCTTCAGATGAAAGGGAGCAGTGTCAAAAGAAGACGAAATCCACCATATGCGAAGCCTCTAACTTTAGGACATCAAGGAGAAGATTCTGCAGCAACAACAAAAATGAAGAGGAGATGAACAATAAGGGAGTTTCAACAACACTGAAGCTTTACGATGATCCTTGGAAGATCAAGAAGACGCTAACCGATAGCGATTTGGGAATCCTAAGTAGACTCTTGCTGGCTGCAGATTTGGTGAAGAAACAAATTTTGCCTATGTTGGGTGCATATCATGCAAGAGCTGCAGAAACTGAAGGGACCCCAGTTAGAGTTTGGGACATGGACACCAAATCCATGCACCAACTCGTTCTAAAGCGATGGTCTTCATCCAAGAGCTATGTTCTTATTGGAAAGTGGAACCAAGATTTCGTCAGAAGAAGAGATCTCAGGAAAGGTGATGAGATCGGATTTCATTGGGATCCATATAATTGCGTTTTCAATTTCTGTGTCCTTAAACAAGCTATGCCAGAGAATTAA

Predicted protein sequences of Glyma06g23026

Limit To All Plant Sequences

>Glyma06g23026.1   sequence type=predicted peptide   gene model=Glyma06g23026   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLKERGNVPSLPFHKYTKKKKNASSVNTQNTQIKPFQPFFLMSLQSQSPSKFTTLFISSNMSNPSDEREQCQKKTKSTICEASNFRTSRRRFCSNNKNEEEMNNKGVSTTLKLYDDPWKIKKTLTDSDLGILSRLLLAADLVKKQILPMLGAYHARAAETEGTPVRVWDMDTKSMHQLVLKRWSSSKSYVLIGKWNQDFVRRRDLRKGDEIGFHWDPYNCVFNFCVLKQAMPEN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain