SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g22240

Feature Type:gene_model
Chromosome:Gm06
Start:19006803
stop:19009707
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g22240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G60970AT Annotation by Michelle Graham. TAIR10: TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5 | chr5:24535570-24536652 REVERSE LENGTH=360 SoyBaseE_val: 1.00E-55ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0016556GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA modification SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0045962GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of development, heterochronic SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
PF03634PFAM TCP family transcription factor JGI ISS
UniRef100_G7IZC4UniRef Annotation by Michelle Graham. Most informative UniRef hit: TCP family transcription factor containing protein n=1 Tax=Medicago truncatula RepID=G7IZC4_MEDTR SoyBaseE_val: 3.00E-128ISS
UniRef100_I1KD23UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KD23_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma06g22240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g22240
ParalogEvidenceComments
Glyma04g32324 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g22240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g204300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g22240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g22240
>Glyma06g22240.1   sequence type=CDS   gene model=Glyma06g22240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGTTGACGATGATGGCAAGTTCAAGAGAAGGTTATCAAGCAAAGCAAGAGGGTGACACAACCACTAATATTGACAAGTTCTCCAAGGCATCTTCTACTACTTCAAGACAATGGTCAGCGTTCAGAAATCCAAGAATTGTGAGAGTGTCTCGTTCTTTTGGAGGGAAAGATAGGCATAGCAAGGTTTGCACCATAAGAGGGTTGAGGGACAGAAGGATTAGGCTCTCGGTTCCCACAGCTATTCAGCTATATGATCTTCAAGACAAGCTTGGACTAAGCCAACCAAGCAAAGTGATAGATTGGTTGCTTGAAGCCACTAAATTTGACATTGACAAGCTCCCTCCACTCCAATTCCCTCAGGGTTTTGGTCAATTTCATCATCATCCACAAACCCTATTCCCTTTTCATGAATCAAGTGCTGCCTCTCATCAGCTGTCTCTTGGACCCTTCAGTGATGCTAGCTCCACTTTTGTGAGGGATGGAGGGATTCAAAACCTCATGGCAAAGTCAAGGTATTGGGAGAACATAAACTCAATGTCAAGATTAAGAGGCAATAAGGAAGCTGAAAAGGGCAAGTGGATCAAAACAAGTGAAGAAGAGAATCATGATCAAGATGGTGTTGTTGGAGGTTACAACAACTTGCAAGTTTCTACTCAAAGGCTTTTCCCAATGGGTAGTAGTACTACTACTACTACTCACTCCCTTTTACCTGGTTTGTTAAACAATTCCATGCCATATAACGCCTACAGTTCTGAGCCTTCTAGTTTATCTTTATCCCAATTTGGAAGCCATGGATTGTTCCCTTCTCAACAAGTAGATCCTAATCCAAGCAGTGGCAACAATGGTGTGCAATTCCAATCTTCTTTGTCATTACCTTCATCGGGCTCTCAATTATTGTTTGGCTCATCTTCTGCTACACCATCAATGTTCACCACCTATGCTCCATTTATTGCACCCTCAGTGGACCCTGATCCAAGACAGTTCAACCACATTCATCAGTTCTTGAACTCAGGCTCTCAAATCTTGCCTCCTCATCCTCTCATACCATCTCTTCATCACCCATTCAATTCACAGATCAGACCCTTCCCAGCAGCACTCTTTAGTTCAAAGCTTTTGGATTCAGACAGCAGCAACCATAGCCAACAAGATCATAAGGGTAGCACTTCTTGA
Predicted protein sequences of Glyma06g22240
>Glyma06g22240.1   sequence type=predicted peptide   gene model=Glyma06g22240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMLTMMASSREGYQAKQEGDTTTNIDKFSKASSTTSRQWSAFRNPRIVRVSRSFGGKDRHSKVCTIRGLRDRRIRLSVPTAIQLYDLQDKLGLSQPSKVIDWLLEATKFDIDKLPPLQFPQGFGQFHHHPQTLFPFHESSAASHQLSLGPFSDASSTFVRDGGIQNLMAKSRYWENINSMSRLRGNKEAEKGKWIKTSEEENHDQDGVVGGYNNLQVSTQRLFPMGSSTTTTTHSLLPGLLNNSMPYNAYSSEPSSLSLSQFGSHGLFPSQQVDPNPSSGNNGVQFQSSLSLPSSGSQLLFGSSSATPSMFTTYAPFIAPSVDPDPRQFNHIHQFLNSGSQILPPHPLIPSLHHPFNSQIRPFPAALFSSKLLDSDSSNHSQQDHKGSTS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo