SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g22081): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g22081): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g22081

Feature Type:gene_model
Chromosome:Gm06
Start:18833688
stop:18837827
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G25350AT Annotation by Michelle Graham. TAIR10: glutamine-tRNA ligase, putative / glutaminyl-tRNA synthetase, putative / GlnRS, putative | chr1:8889280-8894205 REVERSE LENGTH=795 SoyBaseE_val: 2.00E-90ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0006418GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation for protein translation SoyBaseN/AISS
GO:0006424GO-bp Annotation by Michelle Graham. GO Biological Process: glutamyl-tRNA aminoacylation SoyBaseN/AISS
GO:0006425GO-bp Annotation by Michelle Graham. GO Biological Process: glutaminyl-tRNA aminoacylation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0043039GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation SoyBaseN/AISS
GO:0048481GO-bp Annotation by Michelle Graham. GO Biological Process: ovule development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004812GO-mf Annotation by Michelle Graham. GO Molecular Function: aminoacyl-tRNA ligase activity SoyBaseN/AISS
GO:0004819GO-mf Annotation by Michelle Graham. GO Molecular Function: glutamine-tRNA ligase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR10119Panther GLUTAMYL-TRNA SYNTHETASE JGI ISS
PTHR10119:SF15Panther GLUTAMINYL-TRNA SYNTHETASE JGI ISS
PF00749PFAM tRNA synthetases class I (E and Q), catalytic domain JGI ISS
UniRef100_P52780UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamine--tRNA ligase n=1 Tax=Lupinus luteus RepID=SYQ_LUPLU SoyBaseE_val: 1.00E-91ISS
UniRef100_UPI0002338D59UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338D59 related cluster n=1 Tax=unknown RepID=UPI0002338D59 SoyBaseE_val: 9.00E-110ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g22081 not represented in the dataset

Glyma06g22081 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g203400 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g22081.1   sequence type=CDS   gene model=Glyma06g22081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTGTGGCGCTTCCAGGTATGATGATACAAATCCTGAAGCAGAAAAGAAAGAGTATATTGATCACATTGAAGAAAGTGTTCAGTGGATGGGTTGGAAACCATTCAAGATTACTTACACAAGTGATTACTTCCAAGAATTGTACGAATTAGCAGTGGAGCTCATAAAAAAGGGTCATGCTTATGTTGATCATCAGACACCTGATGAGATAAAGGAGCATAGGGAGAAGAAATTGAACAGTCCTTGGAGAGACAGGCCAATTTCAGAGTCATTGAAGCTCTTTGAGGATATGAAAAATGGCAGTATAGAAGAAGGAAAAGCCACACTTAGAATGAAGCAAGACATGCAGAGTGATAACTACAATATGTATGACCTTATTGCATATAGAATTAAGTTTACCCCACACCCTCATGCTGGAGACAAATGGTGTATCTATCCAAGTTATGATTATGCACTTCTCACATTAGGTACACTATAA

>Glyma06g22081.1   sequence type=predicted peptide   gene model=Glyma06g22081   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MACGASRYDDTNPEAEKKEYIDHIEESVQWMGWKPFKITYTSDYFQELYELAVELIKKGHAYVDHQTPDEIKEHREKKLNSPWRDRPISESLKLFEDMKNGSIEEGKATLRMKQDMQSDNYNMYDLIAYRIKFTPHPHAGDKWCIYPSYDYALLTLGTL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo