Glyma06g21982 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g21982): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g21982): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g21982

Feature Type:	gene_model
Chromosome:	Gm06
Start:	18662516
stop:	18664468
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g21982

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G18650	AT	Annotation by Michelle Graham. TAIR10: plasmodesmata callose-binding protein 3 \| chr1:6419036-6420413 REVERSE LENGTH=184	SoyBase	E_val: 7.00E-53	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0001872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: (1->3)-beta-D-glucan binding	SoyBase	N/A	ISS
GO:0030247	GO-mf	Annotation by Michelle Graham. GO Molecular Function: polysaccharide binding	SoyBase	N/A	ISS
PTHR16631	Panther	GLUCAN 1,3-BETA-GLUCOSIDASE-RELATED	JGI		ISS
PTHR16631:SF1	Panther	GLUCAN 1,3-BETA-GLUCOSIDASE	JGI		ISS
PF07983	PFAM	X8 domain	JGI		ISS
UniRef100_B9RLP4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hydrolase, hydrolyzing O-glycosyl compounds, putative n=1 Tax=Ricinus communis RepID=B9RLP4_RICCO	SoyBase	E_val: 3.00E-57	ISS
UniRef100_UPI0002339751	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339751 related cluster n=1 Tax=unknown RepID=UPI0002339751	SoyBase	E_val: 5.00E-72	ISS

Expression Patterns of Glyma06g21982

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g21982 not represented in the dataset	Glyma06g21982 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g21982 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g202600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g21982

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g21982

Limit To All Plant Sequences

>Glyma06g21982.1   sequence type=CDS   gene model=Glyma06g21982   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTTGTTTGCTCTTGCAGTGCTTCTTTTAGCCTTCACTGGCTCTTCAAGTGCCACTTGGTGTGTTTGCAAGGAAGGAAGTGATGCAATATTGCAGAAAACCTTAGATTATGCTTGTGGAGCTGGGGCTGATTGTAACCCTTTGCATCAGAATGGCCCTTGTTTCCAACCCAACACTGTGAGAGCTCACTGTAACTATGCAGTTAACAGCTATTTCCAAAGGAAGGGTCAAGCACAAGGATCCTGTGACTTTGCAGGAACCGCCACTGTTACTGCATCAGATCCCAGCACTGGAGGTTGTTCCTACCCTGCAAGCGCCAGGTATGCATCTTAA

Predicted protein sequences of Glyma06g21982

Limit To All Plant Sequences

>Glyma06g21982.1   sequence type=predicted peptide   gene model=Glyma06g21982   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALFALAVLLLAFTGSSSATWCVCKEGSDAILQKTLDYACGAGADCNPLHQNGPCFQPNTVRAHCNYAVNSYFQRKGQAQGSCDFAGTATVTASDPSTGGCSYPASARYAS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain