SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g20870

Feature Type:gene_model
Chromosome:Gm06
Start:17267690
stop:17269528
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G62440AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF3223) | chr5:25072620-25073917 REVERSE LENGTH=202 SoyBaseE_val: 1.00E-53ISS
GO:0000085GO-bp Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle SoyBaseN/AISS
GO:0000741GO-bp Annotation by Michelle Graham. GO Biological Process: karyogamy SoyBaseN/AISS
GO:0006606GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into nucleus SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0017126GO-bp Annotation by Michelle Graham. GO Biological Process: nucleologenesis SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF11523PFAM Protein of unknown function (DUF3223) JGI ISS
UniRef100_I1KCT7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KCT7_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q8L557UniRef Annotation by Michelle Graham. Most informative UniRef hit: EMB514 n=2 Tax=Arabidopsis thaliana RepID=Q8L557_ARATH SoyBaseE_val: 6.00E-51ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g33570 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g194200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g20870.1   sequence type=CDS   gene model=Glyma06g20870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAAGAAGCAGCACCGAAAGTCGTCGATCCCAACACCGTCGTCGCCGCCGCCGCCGCCGCCGCCGTGGACATGGACGTCGAGAACATCGAGGCCGGCGACAACGGCGCCGAGCCGAACCAGAAGCGCGCCAGGGAGGAAGAGGAGCCCCTGGGCGACGACGACGACGTTTTGAAGAAGCAGAAGGTGGCCGAGGAAAAGGAACAGTCCGTAGAGGAACAGCGGCTGGAGAAGCGCGATGAAAAAGAAGAAAAGGAAGCAGAAAAAGAAGAGGAAGAGAAGGAAGCAAGTGGTTCCGTGAACTTGGGATTCAAGAGCTTCGTTTCTTCCTCGGAGATGTTTCATTACTTCTACAACTTTCTCCATACCTGGCCTCAATATCTCAATGTTAACAAGTATGAACATCTGATGTTGTTGGAGTTGCTTAAGAACGGCCATGCAGAGCCAGATAAAAAGATTGGTGGAGGGGTTCGGGCTTTCCAAGTCCGCAAGCATCCTACCTTCAAAAGCAGGTGCTTTTTCCTCATCAGGGAGGATGACTCTGCTGATGATTTTAGCTTCAGGAAGTGTGTGGATCACATTCTTCCCTTGCCGGAAGAGATGCATTTGAAATTTGATGCGAACAAGGCATTGGGTGGTGGTGGTGGTGGAGGAGGAAAGCATTATGGAGGAGGAAAGGGTGGCAGAGGGGGGAGGGGTGGACGAGGAGGAGGTGGACGTGGTGGTCATGGGAGAGGAGGAAAGTGGAGACATTAA

>Glyma06g20870.1   sequence type=predicted peptide   gene model=Glyma06g20870   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEEAAPKVVDPNTVVAAAAAAAVDMDVENIEAGDNGAEPNQKRAREEEEPLGDDDDVLKKQKVAEEKEQSVEEQRLEKRDEKEEKEAEKEEEEKEASGSVNLGFKSFVSSSEMFHYFYNFLHTWPQYLNVNKYEHLMLLELLKNGHAEPDKKIGGGVRAFQVRKHPTFKSRCFFLIREDDSADDFSFRKCVDHILPLPEEMHLKFDANKALGGGGGGGGKHYGGGKGGRGGRGGRGGGGRGGHGRGGKWRH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo