Glyma06g20830 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g20830

Feature Type:	gene_model
Chromosome:	Gm06
Start:	17232948
stop:	17234471
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g20830

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G74670	AT	Annotation by Michelle Graham. TAIR10: Gibberellin-regulated family protein \| chr1:28053378-28053893 FORWARD LENGTH=101	SoyBase	E_val: 2.00E-40	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009749	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0080167	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to karrikin	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02704	PFAM	Gibberellin regulated protein	JGI		ISS
UniRef100_I1KCT2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KCT2_SOYBN	SoyBase	E_val: 4.00E-72	ISS
UniRef100_Q49RB3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gip1-like protein n=1 Tax=Populus tomentosa RepID=Q49RB3_POPTO	SoyBase	E_val: 1.00E-48	ISS

Expression Patterns of Glyma06g20830

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g20830

Paralog	Evidence	Comments
Glyma04g33610	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g20830 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g193800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g20830

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g20830

Limit To All Plant Sequences

>Glyma06g20830.1   sequence type=CDS   gene model=Glyma06g20830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATGGCTAAGCTTGTATGTGTTCTGCTTCTGGCATTCCTTGGCATTTCCATGATCACAACTCAAGTTATGGCAACAGATTCTGCCTATCACTTGGATGGAAGGAGTTATGGACCTGGGAGTCTAAAGACCTCACAGTGCCCTTCTGAATGCACAAGAAGATGTAGCCAGACACAGTACCACAAGCCGTGCATGTTTTTCTGCCAAGAATGCTGCAAAGTGTGCCTTTGTGTTCCTCCTGGCTACTATGGCAACAAGTCTGTGTGCCCCTGCTACAACAACTGGAAGAACAAGCGTGGAGGACCCAAATGCCCTTGA

Predicted protein sequences of Glyma06g20830

Limit To All Plant Sequences

>Glyma06g20830.1   sequence type=predicted peptide   gene model=Glyma06g20830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMAKLVCVLLLAFLGISMITTQVMATDSAYHLDGRSYGPGSLKTSQCPSECTRRCSQTQYHKPCMFFCQECCKVCLCVPPGYYGNKSVCPCYNNWKNKRGGPKCP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain