SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g20510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g20510): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g20510

Feature Type:gene_model
Chromosome:Gm06
Start:16928571
stop:16931320
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g20510
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G07830AT Annotation by Michelle Graham. TAIR10: ribosomal protein L29 family protein | chr1:2422549-2423392 FORWARD LENGTH=144 SoyBaseE_val: 3.00E-70ISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005761GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial ribosome SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3331 KOG Mitochondrial/chloroplast ribosomal protein L4/L29 JGI ISS
PTHR21183Panther RIBOSOMAL PROTEIN L47, MITOCHONDRIAL-RELATED JGI ISS
PTHR21183:SF11Panther 39S RIBOSOMAL PROTEIN L47, MITOCHONDRIAL-RELATED JGI ISS
PF06984PFAM Mitochondrial 39-S ribosomal protein L47 (MRP-L47) JGI ISS
UniRef100_C6T0Z6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T0Z6_SOYBN SoyBaseE_val: 1.00E-100ISS
UniRef100_D7KHW1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribosomal protein L29 family protein n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KHW1_ARALL SoyBaseE_val: 2.00E-71ISS

Expression Patterns of Glyma06g20510
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g20510 not represented in the dataset
Glyma06g20510 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g20510
ParalogEvidenceComments
Glyma04g33930 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g20510 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g192200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g20510
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g20510
>Glyma06g20510.1   sequence type=CDS   gene model=Glyma06g20510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTTTGTCAAGAACACTTGGACGAACACTCTTTGCTGCTGCTGCCAGATCAAAACAATATGCCACTACAGCAGCTGCTGCTAGCAGAGAAGGACACAACCCCCTTCAGGAGTTTTTTGAGGCAGACAGGAGCCCTGAAGATGACAAACCTGTTGTTTATGGTCGGAGTTGGAAGGCGTGTGAACTGCGTCTGAAGTCTTGGGATGACCTTCATAAGTTGTGGTATGTGTTGTTAAAGGAAAAGAACATGTTGATGACTCAACGTCAAATGCTTAATGCACAGAACCTGCGTTTTCCTAACCCAGAGCGCATCCCTAAGGTGAGGAAGTCAATGTGTCGCATCAAGCATGTACTTACTGAGAGAGCAATTGAAGAACCAGATCCGAGGAGGTCTGCTGAGATGAAGAGAATGATAAATGCTCTTTGA
Predicted protein sequences of Glyma06g20510
>Glyma06g20510.1   sequence type=predicted peptide   gene model=Glyma06g20510   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFLSRTLGRTLFAAAARSKQYATTAAAASREGHNPLQEFFEADRSPEDDKPVVYGRSWKACELRLKSWDDLHKLWYVLLKEKNMLMTQRQMLNAQNLRFPNPERIPKVRKSMCRIKHVLTERAIEEPDPRRSAEMKRMINAL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo