|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G47000 | AT | Annotation by Michelle Graham. TAIR10: ATP binding cassette subfamily B4 | chr2:19310008-19314750 REVERSE LENGTH=1286 | SoyBase | E_val: 4.00E-34 | ISS |
| GO:0000303 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to superoxide | SoyBase | N/A | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0006888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0007165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: signal transduction | SoyBase | N/A | ISS |
| GO:0009407 | GO-bp | Annotation by Michelle Graham. GO Biological Process: toxin catabolic process | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009630 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gravitropism | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009723 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus | SoyBase | N/A | ISS |
| GO:0009733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus | SoyBase | N/A | ISS |
| GO:0009735 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cytokinin stimulus | SoyBase | N/A | ISS |
| GO:0009737 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus | SoyBase | N/A | ISS |
| GO:0009738 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009743 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to carbohydrate stimulus | SoyBase | N/A | ISS |
| GO:0009753 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus | SoyBase | N/A | ISS |
| GO:0009873 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway | SoyBase | N/A | ISS |
| GO:0009926 | GO-bp | Annotation by Michelle Graham. GO Biological Process: auxin polar transport | SoyBase | N/A | ISS |
| GO:0010315 | GO-bp | Annotation by Michelle Graham. GO Biological Process: auxin efflux | SoyBase | N/A | ISS |
| GO:0010540 | GO-bp | Annotation by Michelle Graham. GO Biological Process: basipetal auxin transport | SoyBase | N/A | ISS |
| GO:0010583 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone | SoyBase | N/A | ISS |
| GO:0042538 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response | SoyBase | N/A | ISS |
| GO:0043090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid import | SoyBase | N/A | ISS |
| GO:0043161 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
| GO:0043248 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome assembly | SoyBase | N/A | ISS |
| GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
| GO:0051788 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to misfolded protein | SoyBase | N/A | ISS |
| GO:0055085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane transport | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0008559 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: xenobiotic-transporting ATPase activity | SoyBase | N/A | ISS |
| GO:0016887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity | SoyBase | N/A | ISS |
| GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
| GO:0042626 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of substances | SoyBase | N/A | ISS |
| PTHR24222 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24222:SF96 | Panther | JGI | ISS | ||
| PF00664 | PFAM | ABC transporter transmembrane region | JGI | ISS | |
| UniRef100_B9RN48 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Multidrug resistance protein 1, 2, putative n=1 Tax=Ricinus communis RepID=B9RN48_RICCO | SoyBase | E_val: 1.00E-34 | ISS |
| UniRef100_I1KCN6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KCN6_SOYBN | SoyBase | E_val: 6.00E-55 | ISS |
|
Glyma06g20133 not represented in the dataset |
Glyma06g20133 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.06g189300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma06g20133.1 sequence type=CDS gene model=Glyma06g20133 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCAGGTGACACACTTCTTATTCAAGAAGCCCTGGGAGAGAAGGTAGGAAAATTCATACAGTGTGTGGCATGTTTTTTAGGAGGTTTAGTCATAGCATTCATCAAGGGTTGGCTTCTAACCCTTGTCCTTCTATCTTGCATTCCACCTCTTGTCATCTCTGGTTCCATGATGAGCTTTGCTTTTGAAAAGTTGGCATCCCGTGGACAAGCAGCTTATTCTGAAGCAGCAACTGTAGTAGAGCGCACAATTGGTTCAATTCGACAAGTATGCCAATCTTCATAA
>Glyma06g20133.1 sequence type=predicted peptide gene model=Glyma06g20133 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSGDTLLIQEALGEKVGKFIQCVACFLGGLVIAFIKGWLLTLVLLSCIPPLVISGSMMSFAFEKLASRGQAAYSEAATVVERTIGSIRQVCQSS*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||