SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g19310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g19310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g19310

Feature Type:gene_model
Chromosome:Gm06
Start:15528528
stop:15530914
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G22220AT Annotation by Michelle Graham. TAIR10: SufE/NifU family protein | chr4:11759444-11760881 REVERSE LENGTH=167 SoyBaseE_val: 1.00E-87ISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0051536GO-mf Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding SoyBaseN/AISS
KOG3361 KOG Iron binding protein involved in Fe-S cluster formation JGI ISS
PTHR10093Panther NITROGEN FIXATION PROTEIN NIFU JGI ISS
PF01592PFAM NifU-like N terminal domain JGI ISS
UniRef100_B7FHC6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Iron sulfur cluster assembly protein n=1 Tax=Medicago truncatula RepID=B7FHC6_MEDTR SoyBaseE_val: 4.00E-100ISS
UniRef100_I1KCF6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KCF6_SOYBN SoyBaseE_val: 2.00E-122ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g19310 not represented in the dataset

Glyma06g19310 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g182000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g19310.1   sequence type=CDS   gene model=Glyma06g19310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGAGAATCGCCGCAAGCGCAAAGAGAATTGTTCAAACGGCGTCGTTGGAGGCGCCACCGTTGGGGATTAGGGTTCTGCCGCGTCTCTACCACGAGAGGGTGGTGGACCACTACGACAACCCCCGCAACGTTGGATCCTTCGACAAGAACGACCCCACCGTCGGAACGGGTCTTGTTGGTGCACCCGCGTGTGGCGACGTCATGAAGCTCCAGATTAAGGTTGACGACAAAACGGGGAAGATCGTCGATGCTCGCTTCAAAACCTTCGGTTGTGGATCCGCCATTGCTTCTTCCTCCGTCGCTACTGAATGGGTGAAGGGAAAGCAAATGGAGGAAGTTTTGACCATTAAAAACACTGAAATTGCAAAGCATCTTTCACTTCCACCAGTCAAGCTTCACTGCAGCATGCTTGCTGAGGATGCTATAAAAGCAGCTGTTAAAGATTATGAAGCTAAGCGTGCCTCAGCATCTGCTGGTGGACAGGCAACAACTGGAGAGAAAGCTGTCACTGCTTGA

>Glyma06g19310.1   sequence type=predicted peptide   gene model=Glyma06g19310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLRIAASAKRIVQTASLEAPPLGIRVLPRLYHERVVDHYDNPRNVGSFDKNDPTVGTGLVGAPACGDVMKLQIKVDDKTGKIVDARFKTFGCGSAIASSSVATEWVKGKQMEEVLTIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYEAKRASASAGGQATTGEKAVTA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo