SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g18460

Feature Type:gene_model
Chromosome:Gm06
Start:14796532
stop:14798087
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma06g18460
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48330AT Annotation by Michelle Graham. TAIR10: protein-l-isoaspartate methyltransferase 1 | chr3:17892969-17893975 REVERSE LENGTH=230 SoyBaseE_val: 4.00E-58ISS
GO:0006464GO-bp Annotation by Michelle Graham. GO Biological Process: cellular protein modification process SoyBaseN/AISS
GO:0007568GO-bp Annotation by Michelle Graham. GO Biological Process: aging SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004719GO-mf Annotation by Michelle Graham. GO Molecular Function: protein-L-isoaspartate (D-aspartate) O-methyltransferase activity SoyBaseN/AISS
KOG1661 KOG Protein-L-isoaspartate(D-aspartate) O-methyltransferase JGI ISS
PTHR11579Panther PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE JGI ISS
PF01135PFAM Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) JGI ISS
UniRef100_I1JXD8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein-L-isoaspartate O-methyltransferase n=3 Tax=Glycine max RepID=I1JXD8_SOYBN SoyBaseE_val: 1.00E-82ISS
UniRef100_I1KC92UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KC92_SOYBN SoyBaseE_val: 2.00E-154ISS

Expression Patterns of Glyma06g18460
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g18460
ParalogEvidenceComments
Glyma04g36430 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g18460 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g175300 Wm82.a2.v1IGC As supplied by JGI

References for Glyma06g18460
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma06g18460
>Glyma06g18460.1   sequence type=CDS   gene model=Glyma06g18460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGCGATTTTGCTCATTGAGTGGCATGAGTAATAACAAAGCACTGGTGGAGAGGTTGCAGCGCTATGGAGTGATCACATCAAGTAAGGAGGCTGAAGTGATGGAGACAGTTGATAAAGCCTTGTTTGTACCAGATGGAGCTGCACCTTATGATGACAGCCCCATGGCCATAGGGTACAATGCCACTATATCTGCGCCGCATATGCTGGAGGAAAATTTGCAGCCTGGGATGCATGCTTTGGACGTTGGCTATGTTCTACATCACCCTCCTTCCTTGGAGAAGTTGTATAGGCGTAGCAAGATGAACGGGGTACCTGACTGCTGCTTTGCCTTAATGGTTGGACCCCATGGCCGTGCTGTTGGTAGAATATTCAGAAAAGTGCTGCAGCTGCCAATTGAAAGAGGGTTCCCTTTCTGTCCATGCTGGTGGTTATTGAGTCCACTAAATCTGAAAGTAGAGTTGATCCACAAGTATTTTTCTTGTTATGATGGAAGGCAAGGTTGGCCAGAGTTTGCACCTTATGATGCCATTCACGTTGGAGCAGCAGCACCAGAAATTCCCCAACCACTTATTGACCAGTTGAAGCCTGGAGGAAGAATGTTGAGTCCTGTTGGAAACATTTTTCAA
Predicted protein sequences of Glyma06g18460
>Glyma06g18460.1   sequence type=predicted peptide   gene model=Glyma06g18460   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQRFCSLSGMSNNKALVERLQRYGVITSSKEAEVMETVDKALFVPDGAAPYDDSPMAIGYNATISAPHMLEENLQPGMHALDVGYVLHHPPSLEKLYRRSKMNGVPDCCFALMVGPHGRAVGRIFRKVLQLPIERGFPFCPCWWLLSPLNLKVELIHKYFSCYDGRQGWPEFAPYDAIHVGAAAPEIPQPLIDQLKPGGRMLSPVGNIFQ






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo