SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g18020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g18020): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g18020

Feature Type:gene_model
Chromosome:Gm06
Start:14338177
stop:14341148
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G63400AT Annotation by Michelle Graham. TAIR10: adenylate kinase 1 | chr5:25393502-25394817 REVERSE LENGTH=190 SoyBaseE_val: 1.00E-75ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0009749GO-bp Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus SoyBaseN/AISS
GO:0009750GO-bp Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0046939GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide phosphorylation SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0004017GO-mf Annotation by Michelle Graham. GO Molecular Function: adenylate kinase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016776GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, phosphate group as acceptor SoyBaseN/AISS
GO:0019205GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleobase-containing compound kinase activity SoyBaseN/AISS
PTHR23359Panther ADENYLATE KINASE JGI ISS
PF00406PFAM Adenylate kinase JGI ISS
PF05191PFAM Adenylate kinase, active site lid JGI ISS
UniRef100_B9I3N9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Adenylate kinase 6 n=1 Tax=Populus trichocarpa RepID=B9I3N9_POPTR SoyBaseE_val: 1.00E-77ISS
UniRef100_I1KC53UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1KC53_SOYBN SoyBaseE_val: 2.00E-96ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g18020 not represented in the dataset

Glyma06g18020 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g171800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g18020.2   sequence type=CDS   gene model=Glyma06g18020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGAGATTGGTCACGCCTATTTAATGAGCGTGCCCTGTCCACCTGGGTCAGGAAAAGGCACCCAGTCACCAAGCATAAGAGATGAGTACTGCTTGTGCCACTTAGCTACTAGTGACATGTTAAGAGCAGCTGTGACAGCTAAAACCCCTTCTGGTATTAAGGCTAAAGAAGCTATGGATAATGGACAACTTCTTTCTGATGACTTGAAACCATCATGTCAAAAAGGTTTCATTCTTGATGGTTTTCCAAGAACTGTGGTCCAAGCACAGAAGCTTGATGAGATACTGGAAAAGCAGGGAAATAAAGTTGATAAGGTACTCAATTTTGCAATTTATGATGCTATCCTTGAGGAGCGGATTACTGGCCACTGGATATGCCCATCCACTGGCAAAACTTACCATACAAAATTTGCTCCTCCAAAGGTCCCTGGGGTTGATGATTTACTGGTGAACCTCTTATTCAACGCAAGGATGACCCTGCAACTGTTCTTAAGTCAAGACTAG

>Glyma06g18020.2   sequence type=predicted peptide   gene model=Glyma06g18020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEIGHAYLMSVPCPPGSGKGTQSPSIRDEYCLCHLATSDMLRAAVTAKTPSGIKAKEAMDNGQLLSDDLKPSCQKGFILDGFPRTVVQAQKLDEILEKQGNKVDKVLNFAIYDAILEERITGHWICPSTGKTYHTKFAPPKVPGVDDLLVNLLFNARMTLQLFLSQD*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo