Glyma06g17960 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g17960

Feature Type:	gene_model
Chromosome:	Gm06
Start:	14292668
stop:	14296362
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g17960

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G26340	AT	Annotation by Michelle Graham. TAIR10: N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein \| chr3:9650600-9652572 REVERSE LENGTH=273	SoyBase	E_val: 2.00E-168	ISS
GO:0006511	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process	SoyBase	N/A	ISS
GO:0051603	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process	SoyBase	N/A	ISS
GO:0000502	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005839	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proteasome core complex	SoyBase	N/A	ISS
GO:0004175	GO-mf	Annotation by Michelle Graham. GO Molecular Function: endopeptidase activity	SoyBase	N/A	ISS
GO:0004298	GO-mf	Annotation by Michelle Graham. GO Molecular Function: threonine-type endopeptidase activity	SoyBase	N/A	ISS
KOG0175	KOG	20S proteasome, regulatory subunit beta type PSMB5/PSMB8/PRE2	JGI		ISS
PTHR11599	Panther	PROTEASOME SUBUNIT ALPHA/BETA	JGI		ISS
PTHR11599:SF3	Panther	PROTEASOME BETA SUBUNIT	JGI		ISS
PF00227	PFAM	Proteasome subunit	JGI		ISS
UniRef100_I1KC47	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Proteasome subunit beta type n=1 Tax=Glycine max RepID=I1KC47_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1KC47	UniRef	Annotation by Michelle Graham. Best UniRef hit: Proteasome subunit beta type n=1 Tax=Glycine max RepID=I1KC47_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma06g17960

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g17960

Paralog	Evidence	Comments
Glyma04g37030	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g17960 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g171200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g17960

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g17960

Limit To All Plant Sequences

>Glyma06g17960.1   sequence type=CDS   gene model=Glyma06g17960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCTCGATACCACCGGTCTCGAATCGTTTCCCACACTGCTTGCGCCTCAAAACGACGTCGTTGGAGAACTCTCCGCCGCTCCATCCTTCGACCTTCCGAATTCCAACGATTTCGATGGGTTTGTGAAAGAAGCTATTCAGATGGTGAAGCCCGCGAAGGGTACTACGACTCTTGCTTTTATATTTAAGGAGGGTGTTATGGTAGCTGCTGATTCTCGAGCTAGCATGGGAGGATATATATCATCGCAGTCTGTGAAGAAGATTATTGAAATTAATCCGTATATGCTTGGGACAATGGCTGGAGGTGCTGCTGATTGTCAGTTTTGGCACAGGAATCTTGGGATCAAGTGTCGTTTGCACGAGTTGGCAAATAAAAGGAGAATTTCAGTGACAGGAGCCTCAAAGCTACTTGCCAATATTTTATACTCTTATCGTGGAATGGGGTTATCTGTTGGTACCATGATTGCTGGATGGGATGAGACGGGTCCTGGTCTATATTATGTTGATAGTGAAGGAGGAAGACTTAAAGGCACTAGATTCTCTGTTGGATCTGGTTCACCATATGCTTATGGTGTATTGGACAGCGGGTACCGATATGACCTGTCAGTTGAGGAAGCTGCTGAACTTGCTCGACGAGCAATTTATCACGCAACATTTCGTGATGGGGCCAGTGGTGGAGTTGCTAGCGTTTACTATGTGGGTCCAAATGGATGGAAGAAATTGTCCGGTGATGATGTTGGGGAACTTCATTACCATTACTACCCAGTTACCCCAAGCACCGTGGAACAAGAAATGGTTGAGGCAACTGGAGCTTGA

Predicted protein sequences of Glyma06g17960

Limit To All Plant Sequences

>Glyma06g17960.1   sequence type=predicted peptide   gene model=Glyma06g17960   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKLDTTGLESFPTLLAPQNDVVGELSAAPSFDLPNSNDFDGFVKEAIQMVKPAKGTTTLAFIFKEGVMVAADSRASMGGYISSQSVKKIIEINPYMLGTMAGGAADCQFWHRNLGIKCRLHELANKRRISVTGASKLLANILYSYRGMGLSVGTMIAGWDETGPGLYYVDSEGGRLKGTRFSVGSGSPYAYGVLDSGYRYDLSVEEAAELARRAIYHATFRDGASGGVASVYYVGPNGWKKLSGDDVGELHYHYYPVTPSTVEQEMVEATGA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain