SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g17950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g17950): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g17950

Feature Type:gene_model
Chromosome:Gm06
Start:14288212
stop:14288634
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G76650AT Annotation by Michelle Graham. TAIR10: calmodulin-like 38 | chr1:28766909-28767442 REVERSE LENGTH=177 SoyBaseE_val: 9.00E-36ISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009620GO-bp Annotation by Michelle Graham. GO Biological Process: response to fungus SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009723GO-bp Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009873GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0035556GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
KOG0027 KOG Calmodulin and related proteins (EF-Hand superfamily) JGI ISS
PTHR10891Panther CALMODULIN JGI ISS
PTHR10891:SF141Panther CALCIUM-BINDING PROTEIN JGI ISS
PF00036PFAM EF hand JGI ISS
UniRef100_G7J5J1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calmodulin-like protein n=2 Tax=Medicago truncatula RepID=G7J5J1_MEDTR SoyBaseE_val: 2.00E-68ISS
UniRef100_I1KC46UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1KC46_SOYBN SoyBaseE_val: 2.00E-93ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g17950 not represented in the dataset

Glyma06g17950 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g37040 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g17950.1   sequence type=CDS   gene model=Glyma06g17950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAGCAAGTTGGCTTTGAGGATGTTCTAAGATACTTTGACGAAGATGGTGATGGAAAGGTTTCGCCTTCAGAGCTGAAGCACGGGCTCGGAATGATGGGTGGTGAGCTTCCAATGAAGGAAGCTGAGATGGCAATTGCGGCATTGGATTCTGATGGAGATGGGTTGCTGAGTTTGGAGGATTTCATTGCTCTCATGGAAGCTGGGGGAGAGGAGCAGAAGTTGAATGACTTGAAGGTAGCTTTTGAGATGTATGACACTGAAAGGTGTGGGTTTATAACCCCTAAGAGCTTGAAAAAGATGCTTAAGAAGATGGGTGAGTCCAAATCCATTGATGAGTGCAAATCTATGATCAAACAGTTTGATTTGAATGGGGATGGTGTCCTAAGCTTTGAAGAATTCAGAATTATGATGCAGTGA

>Glyma06g17950.1   sequence type=predicted peptide   gene model=Glyma06g17950   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKQVGFEDVLRYFDEDGDGKVSPSELKHGLGMMGGELPMKEAEMAIAALDSDGDGLLSLEDFIALMEAGGEEQKLNDLKVAFEMYDTERCGFITPKSLKKMLKKMGESKSIDECKSMIKQFDLNGDGVLSFEEFRIMMQ*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo