Glyma06g17780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g17780

Feature Type:	gene_model
Chromosome:	Gm06
Start:	14131276
stop:	14136006
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g17780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G48590	AT	Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit C1 \| chr3:18008893-18009938 REVERSE LENGTH=234	SoyBase	E_val: 4.00E-102	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016602	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: CCAAT-binding factor complex	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
KOG1657	KOG	CCAAT-binding factor, subunit C (HAP5)	JGI		ISS
PTHR10252	Panther	HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED	JGI		ISS
PF00808	PFAM	Histone-like transcription factor (CBF/NF-Y) and archaeal histone	JGI		ISS
UniRef100_G7J3W1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transcription factor Y subunit C-1 n=1 Tax=Medicago truncatula RepID=G7J3W1_MEDTR	SoyBase	E_val: 3.00E-106	ISS
UniRef100_I1KC24	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KC24_SOYBN	SoyBase	E_val: 3.00E-166	ISS

Expression Patterns of Glyma06g17780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g17780

Paralog	Evidence	Comments
Glyma04g37291	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g17780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g169600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g17780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g17780

Limit To All Plant Sequences

>Glyma06g17780.1   sequence type=CDS   gene model=Glyma06g17780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGACCAACAACCAGCAACAACAACAACAAGGAGCTCAAGCCCAATCGGGACCCTACCCCGTCGCCGGCGCCGGCGGCAGTGCAGGTGCAGGTGCAGGCGCTCCTCCCCCTTTCCAGCACCTTCTCCAGCAGCAGCAGCAGCAGCTCCAGATGTTCTGGTCTTACCAGCGTCAAGAAATCGAGCACGTGAACGACTTTAAGAATCACCAGCTCCCTCTTGCCCGCATCAAGAAGATCATGAAGGCCGACGAGGATGTCCGCATGATCTCCGCCGAGGCCCCCATCCTCTTCGCCAAGGCCTGCGAGCTCTTCATCCTCGAGCTCACCATCCGCTCCTGGCTCCACGCCGAGGAGAACAAGCGCCGCACCCTCCAGAAGAACGACATCGCCGCCGCCATCACCCGCACCGACATTTTCGACTTCCTCGTTGATATTGTCCCCCGCGACGAGATCAAGGACGACGCTGCTCTTGTGGGGGCCACCGCCAGTGGGGTGCCTTACTACTACCCGCCCATTGGACAGCCTGCCGGGATGATGATTGGCCGCCCCGCCGTCGATCCCGCCACCGGGGTTTATGTCCAGCCGCCCTCCCAGGCATGGCAGTCCGTCTGGCAGTCCGCTGCCGAGGACGCTTCCTATGGCACCGGCGGGGCCGGTGCCCAGCGGAGCCTTGATGGCCAGAGTTGA

Predicted protein sequences of Glyma06g17780

Limit To All Plant Sequences

>Glyma06g17780.1   sequence type=predicted peptide   gene model=Glyma06g17780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METNNQQQQQQGAQAQSGPYPVAGAGGSAGAGAGAPPPFQHLLQQQQQQLQMFWSYQRQEIEHVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIKDDAALVGATASGVPYYYPPIGQPAGMMIGRPAVDPATGVYVQPPSQAWQSVWQSAAEDASYGTGGAGAQRSLDGQS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain