SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma06g17780

Feature Type:gene_model
Chromosome:Gm06
Start:14131276
stop:14136006
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48590AT Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit C1 | chr3:18008893-18009938 REVERSE LENGTH=234 SoyBaseE_val: 4.00E-102ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0016602GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CCAAT-binding factor complex SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
KOG1657 KOG CCAAT-binding factor, subunit C (HAP5) JGI ISS
PTHR10252Panther HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED JGI ISS
PF00808PFAM Histone-like transcription factor (CBF/NF-Y) and archaeal histone JGI ISS
UniRef100_G7J3W1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transcription factor Y subunit C-1 n=1 Tax=Medicago truncatula RepID=G7J3W1_MEDTR SoyBaseE_val: 3.00E-106ISS
UniRef100_I1KC24UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KC24_SOYBN SoyBaseE_val: 3.00E-166ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma04g37291 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.06g169600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g17780.1   sequence type=CDS   gene model=Glyma06g17780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGACCAACAACCAGCAACAACAACAACAAGGAGCTCAAGCCCAATCGGGACCCTACCCCGTCGCCGGCGCCGGCGGCAGTGCAGGTGCAGGTGCAGGCGCTCCTCCCCCTTTCCAGCACCTTCTCCAGCAGCAGCAGCAGCAGCTCCAGATGTTCTGGTCTTACCAGCGTCAAGAAATCGAGCACGTGAACGACTTTAAGAATCACCAGCTCCCTCTTGCCCGCATCAAGAAGATCATGAAGGCCGACGAGGATGTCCGCATGATCTCCGCCGAGGCCCCCATCCTCTTCGCCAAGGCCTGCGAGCTCTTCATCCTCGAGCTCACCATCCGCTCCTGGCTCCACGCCGAGGAGAACAAGCGCCGCACCCTCCAGAAGAACGACATCGCCGCCGCCATCACCCGCACCGACATTTTCGACTTCCTCGTTGATATTGTCCCCCGCGACGAGATCAAGGACGACGCTGCTCTTGTGGGGGCCACCGCCAGTGGGGTGCCTTACTACTACCCGCCCATTGGACAGCCTGCCGGGATGATGATTGGCCGCCCCGCCGTCGATCCCGCCACCGGGGTTTATGTCCAGCCGCCCTCCCAGGCATGGCAGTCCGTCTGGCAGTCCGCTGCCGAGGACGCTTCCTATGGCACCGGCGGGGCCGGTGCCCAGCGGAGCCTTGATGGCCAGAGTTGA

>Glyma06g17780.1   sequence type=predicted peptide   gene model=Glyma06g17780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
METNNQQQQQQGAQAQSGPYPVAGAGGSAGAGAGAPPPFQHLLQQQQQQLQMFWSYQRQEIEHVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIKDDAALVGATASGVPYYYPPIGQPAGMMIGRPAVDPATGVYVQPPSQAWQSVWQSAAEDASYGTGGAGAQRSLDGQS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo