Glyma06g17690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g17690

Feature Type:	gene_model
Chromosome:	Gm06
Start:	14040706
stop:	14041941
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g17690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G13080	AT	Annotation by Michelle Graham. TAIR10: WRKY DNA-binding protein 75 \| chr5:4149928-4151019 REVERSE LENGTH=145	SoyBase	E_val: 6.00E-41	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0016036	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation	SoyBase	N/A	ISS
GO:0019375	GO-bp	Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process	SoyBase	N/A	ISS
GO:0032107	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of response to nutrient levels	SoyBase	N/A	ISS
GO:0042631	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation	SoyBase	N/A	ISS
GO:0043620	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of DNA-dependent transcription in response to stress	SoyBase	N/A	ISS
GO:0048527	GO-bp	Annotation by Michelle Graham. GO Biological Process: lateral root development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0043565	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding	SoyBase	N/A	ISS
PF03106	PFAM	WRKY DNA -binding domain	JGI		ISS
UniRef100_A7LHG8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: WRKY25 n=1 Tax=Glycine max RepID=A7LHG8_SOYBN	SoyBase	E_val: 3.00E-50	ISS
UniRef100_I1KC14	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KC14_SOYBN	SoyBase	E_val: 1.00E-79	ISS

Proteins Associated with Glyma06g17690

Locus	Gene Symbol	Protein Name
	WRKY100	WRKY Transcription Factor

Expression Patterns of Glyma06g17690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g17690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g168400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g17690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g17690

Limit To All Plant Sequences

>Glyma06g17690.2   sequence type=CDS   gene model=Glyma06g17690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAACACCAAGTGATGCTCCCTACTTCATCTACATCATCAACTCCCTTTTCATCTGATTTTAAAGTTGATTATATTAATTCTACTGTTCATGTTGAGAATGAGGCTATAAGAACTCAAAGGAAGGCCATATCAGCGCAGAACAAAAGAGACAAAGAGTTTATAATTAAGCAGCACAGATATGTATTTCAAACAAAGAGTCCGGTTGATGTTCTGGACGATGGGTACCAGTGGAGAAAATATGGGAAAAAGATAGTGAAAAACAATAAGTTTCCAAGAAGTTACTACAGGTGCTCTCATCAAGATTGCAATGTCAAGAAACAAATCCAACGCCATTCCCGAGATGAACAGATTGTGGTAACAACCTACGAAGGGACACATACACACCCAGTCGACAAGTCAGCGGAAAGCTTCGACCAAATCTTGGGAAACCTACTCATAGGCAACCTAGTATGTAATGTGCCTCCCACATTGGAATAG

Predicted protein sequences of Glyma06g17690

Limit To All Plant Sequences

>Glyma06g17690.2   sequence type=predicted peptide   gene model=Glyma06g17690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKHQVMLPTSSTSSTPFSSDFKVDYINSTVHVENEAIRTQRKAISAQNKRDKEFIIKQHRYVFQTKSPVDVLDDGYQWRKYGKKIVKNNKFPRSYYRCSHQDCNVKKQIQRHSRDEQIVVTTYEGTHTHPVDKSAESFDQILGNLLIGNLVCNVPPTLE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain