Glyma06g17660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g17660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g17660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g17660

Feature Type:	gene_model
Chromosome:	Gm06
Start:	14006075
stop:	14006203
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g17660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G51630	AT	Annotation by Michelle Graham. TAIR10: with no lysine (K) kinase 5 \| chr3:19149487-19151924 FORWARD LENGTH=549	SoyBase	E_val: 6.00E-16	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0048573	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
GO:0043424	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein histidine kinase binding	SoyBase	N/A	ISS
PTHR13902	Panther	SERINE/THREONINE-PROTEIN KINASE WNK (WITH NO LYSINE)-RELATED	JGI		ISS
PTHR13902:SF35	Panther	WNK5 (ARABIDOPSIS WNK KINASE 5)	JGI		ISS
UniRef100_C0M0Q1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C0M0Q1_SOYBN	SoyBase	E_val: 6.00E-18	ISS
UniRef100_G7KX47	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: With no lysine kinase n=1 Tax=Medicago truncatula RepID=G7KX47_MEDTR	SoyBase	E_val: 1.00E-15	ISS

Expression Patterns of Glyma06g17660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g17660 not represented in the dataset	Glyma06g17660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma06g17660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma06g17660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g17660

Limit To All Plant Sequences

>Glyma06g17660.1   sequence type=CDS   gene model=Glyma06g17660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGAAAGAAGCAATGAAGACTGAGTATAGGGCATTTGATGAGTTACTAGGGATTGAAGTGGCTTGGAACCAAGTCAAGCTTGGTGATGTCTTTCACTCACCAGAGCAACTCCAACGCCTTTATTAA

Predicted protein sequences of Glyma06g17660

Limit To All Plant Sequences

>Glyma06g17660.1   sequence type=predicted peptide   gene model=Glyma06g17660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKEAMKTEYRAFDELLGIEVAWNQVKLGDVFHSPEQLQRLY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain