Glyma06g17610 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g17610

Feature Type:	gene_model
Chromosome:	Gm06
Start:	13978655
stop:	13980956
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g17610

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G50720	AT	Annotation by Michelle Graham. TAIR10: HVA22 homologue E \| chr5:20633442-20634502 REVERSE LENGTH=116	SoyBase	E_val: 9.00E-50	ISS
GO:0009269	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to desiccation	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR12300	Panther	HVA22-LIKE PROTEINS	JGI		ISS
PTHR12300:SF11	Panther	HVA22-LIKE PROTEIN	JGI		ISS
PF03134	PFAM	TB2/DP1, HVA22 family	JGI		ISS
UniRef100_G7J3D8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: HVA22-like protein e n=1 Tax=Medicago truncatula RepID=G7J3D8_MEDTR	SoyBase	E_val: 2.00E-72	ISS
UniRef100_I1KC07	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KC07_SOYBN	SoyBase	E_val: 2.00E-101	ISS

Expression Patterns of Glyma06g17610

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g17610

Paralog	Evidence	Comments
Glyma04g37440	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g17610 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g167900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g17610

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g17610

Limit To All Plant Sequences

>Glyma06g17610.1   sequence type=CDS   gene model=Glyma06g17610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCAAGTTGTGGACCTTGATCATCCAGCTTCATTCTATTGCTGGGCCGGTTGTGACGTTATTGTACCCTTTGTATGCATCGGTGGTAGCAATAGAGAGCCAGTCCAAGTTGGATGACGAGCAATGGCTAGCTTATTGGATCATCTATTCGTTCCTCACCCTTGCGGAAATGGTTCTTCAACCTATCTTAGAGTGGATACCAATTTGGTACGATGTGAAACTATTGACGGTGGCATGGCTGGTGTTGCCACAGTTCGCAGGAGCTGCGTACTTATATGAAAGGTTCGTGAGAGAGCATATAAGGAAATATATAACGGAGAGACAGTATCTCTATGGCAACCACCAGCAACAAAGCAAAAAGTCTCCCAATAACGGTGGCAAGGCCAAGAAATTCGTCGAATTCGTCACGCCCAAGAAAGGGGATCAGGAGGCATATTGA

Predicted protein sequences of Glyma06g17610

Limit To All Plant Sequences

>Glyma06g17610.1   sequence type=predicted peptide   gene model=Glyma06g17610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGKLWTLIIQLHSIAGPVVTLLYPLYASVVAIESQSKLDDEQWLAYWIIYSFLTLAEMVLQPILEWIPIWYDVKLLTVAWLVLPQFAGAAYLYERFVREHIRKYITERQYLYGNHQQQSKKSPNNGGKAKKFVEFVTPKKGDQEAY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain