Glyma06g17540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma06g17540

Feature Type:	gene_model
Chromosome:	Gm06
Start:	13901720
stop:	13904519
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma06g17540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G50790	AT	Annotation by Michelle Graham. TAIR10: Nodulin MtN3 family protein \| chr5:20656461-20657827 REVERSE LENGTH=289	SoyBase	E_val: 9.00E-98	ISS
GO:0015770	GO-bp	Annotation by Michelle Graham. GO Biological Process: sucrose transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005887	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0008515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sucrose transmembrane transporter activity	SoyBase	N/A	ISS
GO:0051119	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sugar transmembrane transporter activity	SoyBase	N/A	ISS
KOG1623	KOG	Multitransmembrane protein	JGI		ISS
PTHR10791	Panther	STROMAL CELL PROTEIN/NODULIN MTN3-RELATED	JGI		ISS
PF03083	PFAM	MtN3/saliva family	JGI		ISS
UniRef100_A7XWR9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: N3 protein n=1 Tax=Glycine max RepID=A7XWR9_SOYBN	SoyBase	E_val: 2.00E-157	ISS
UniRef100_I1KC00	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KC00_SOYBN	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma06g17540

Locus	Gene Symbol	Protein Name
	SWEET17	sucrose transporter gene 17
	SWEET17	sucrose effluxer gene 17

Expression Patterns of Glyma06g17540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma06g17540

Paralog	Evidence	Comments
Glyma04g37510	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma06g17540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.06g167000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma06g17540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma06g17540

Limit To All Plant Sequences

>Glyma06g17540.1   sequence type=CDS   gene model=Glyma06g17540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATCAACCATGAAACTTGGGCTTTCATTTTCGGTCTTCTAGGCAACGTGATCTCCTTTATGGTGTTCCTCGCTCCATTACCAACTTTTTACCAAATCTACAAGAAAAAATCTACGGATGGGTTTCAATCACTACCTTATATTGTTGCACTATTCAGTTCAATGCTCTGGATTTATTACGCACTCGTCAAAAAGGATGCTAGCCTCCTTCTCATTACTATTAACTCCTTTGGATGTGTGATAGAGACGATATACCTTGCAATCTTCCTAATTTACGCCCCAAGCAAAACCAGGCTTTGGACCATCAAGCTTCTTCTCATGTTGAATGTTTTTGGATTCGGAGCAATGCTTCTTTCAACCCTCTACCTTACAACGGGTTCCAAACGTCTTTCTGTGATAGGATGGATTTGCCTTGTTCTCAACATAAGCGTTTTTGCTGCTCCTCTTTGCATCATGAAACGTGTCATAAAGACGAAGAGTGTGGAATTCATGCCTTTCAGTTTGTCCTTCTTTTTGACCATAAATGCTGTCATGTGGTTCTTCTATGGCCTTCTCCTCAAGGACTACTACATCGCACTCCCAAATACTCTTGGGTTTCTATTCGGCATAATCCAGATGGTGCTGTATTTGATTTATAGAAACGCCAAGCCACAAGGATTAGAGGAGCCAACGAAGGTTCAGGAACTAAATGGCCATATTATTGACGTTGTGAAGCCGAATCATGTAACAAAAAATGGTCCTGTGCCTGTGATTGAGACAGCTAGCAATGTGTGA

Predicted protein sequences of Glyma06g17540

Limit To All Plant Sequences

>Glyma06g17540.1   sequence type=predicted peptide   gene model=Glyma06g17540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAINHETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALVKKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYLTTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYGLLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTKVQELNGHIIDVVKPNHVTKNGPVPVIETASNV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain