SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma06g17111): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma06g17111): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma06g17111

Feature Type:gene_model
Chromosome:Gm06
Start:13446826
stop:13448351
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23760AT Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: vacuole; EXPRESSED IN: 20 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: transferases, transferring glycosyl groups (TAIR:AT4G14100.1); Has 108 Blast hits to 104 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 8; Fungi - 0; Plants - 90; Viruses - 0; Other Eukaryotes - 10 (source: NCBI BLink). | chr3:8562965-8564640 REVERSE LENGTH=194 SoyBaseE_val: 4.00E-56ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_D7MH74UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transferase, transferring glycosyl groups n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7MH74_ARALL SoyBaseE_val: 5.00E-51ISS
UniRef100_UPI00023384A5UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023384A5 related cluster n=1 Tax=unknown RepID=UPI00023384A5 SoyBaseE_val: 1.00E-109ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma06g17111 not represented in the dataset

Glyma06g17111 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma06g17111.1   sequence type=CDS   gene model=Glyma06g17111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGACTTTAACGTGCACGATAGGCAACTTCAACATTCTCCAGTATCAGCTCGACCACCTCGTCACCTACGACCTCCAATGGAACAACGGCACCTCCTTCATCTACACCCTCCATCCCTCAGACCCCACATGCCAAGTTCTGCACTTTCAAGTGGGTATTCTCCGCCCCAATTGGCTCCTCGGCGCCACATATTTGGGTCAGCAGCATGTTGATAATTTCCTCTGTAATGTATGGGAGAAAGTTGATGAGGATGTTCTCACTCGTAGACCTGTTAAGTGGATCTTCTACTCAGGATACACTGCTCACGTGATGACATTGGAGGTTGGTGCAGTGCTTGAGGATCCAAATTGGCAGGCTCCTGTGTATTGTTTTAATGAGAATGAGAAGGAAAAGAATAGCCCCATTTTGAGACCTGCTGTTCGTGGTGGTTATCTTGGGAGTTTGATGAGAGAGATACCCGCTCGGGAAACTAAGTAA

>Glyma06g17111.1   sequence type=predicted peptide   gene model=Glyma06g17111   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQTLTCTIGNFNILQYQLDHLVTYDLQWNNGTSFIYTLHPSDPTCQVLHFQVGILRPNWLLGATYLGQQHVDNFLCNVWEKVDEDVLTRRPVKWIFYSGYTAHVMTLEVGAVLEDPNWQAPVYCFNENEKEKNSPILRPAVRGGYLGSLMREIPARETK*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo